KEGG   Synechococcus elongatus PCC6301: syc1185_d
Entry
syc1185_d         CDS       T00163                                 

Gene name
apcE
Definition
(GenBank) phycobilisome core-membrane linker polypeptide
  KO
K02096  phycobilisome core-membrane linker protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc1185_d (apcE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1185_d (apcE)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Allophycocyanin (AP)
    syc1185_d (apcE)
SSDB
Motif
Pfam: PBS_linker_poly Phycobilisome
Other DBs
NCBI-ProteinID: BAD79375
CyanoBase: syc1185_d
CYORF: syc1185_d
UniProt: P28035
Position
1294984..1297101
AA seq 705 aa
MTVTASGGSSLARPQLYQTVPGSTIVQAEQQDRFPQQGELRELSSYFQSGLKRLAIAEII
TRNSDTIVSRAANRIFVGGSPLAYIERPKVDPRNLRSAEEQRAREAKLGTVTFVESSGGG
GFFSGLTAALGGAGAVRIPSGFRPINVARYGPRNMQKSLRDMSWFLRYITYAIVAGDPNI
LVVNVRGLREIIEKACSTPATLVALQDMRATSAGYFRNDPEAQQLVKDYFDVLIREFEAP
TPSLKQRQRFAEDQQGLALPQSYANAAERRPKFVIKSTLSTVEKNEAIKAAYRQVFERDI
TRAYSQKVSDLESKVKNGEISTKEFIRRLGKSPLYRQQFHDRFVNSRVIELAFRHFLGRG
ISSAEEFTRYFDLLSAKGFAALIDALVDSQEYADYFGEETVPYLRGLGQEAQECRNWGVQ
QELFKYSAPFVKVPQFVTLFGEYKQPLLDQHPYGAGNDPLEIQFGAIFPSRTVNNRTNPA
PFGKDTRRLLVSKGGVNNQVGSAAFQQSGTTPTKIFKLTQVAAGSSSIRSKSVGNPSIRQ
TESTTQAVIRAAYRQVFGRDLYEGQRLTVPEIKLENGEITVREFVRQIAKSETFRKLYWN
NLYVVKAVEYIHRRLLGRPTTGRAEINAYFDISAKKGFYALVDAILDSPEYIAAFGEDTV
PYERYITPKGLALRSVRGLEASEKVKASLRPAAGAQERRPEVGRR
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgacagttacggccagtggcggcagctcacttgcacgcccgcaactctaccaaacggtt
cctggctcgacgattgttcaggcagaacaacaagaccgcttcccgcaacagggtgagctg
cgcgagctttcgagctacttccagtccggcctcaaacggctggcgatcgcagaaatcatc
actcggaattccgacacgattgtctcgcgagcagccaaccggatttttgtcggtggctca
ccccttgcttatattgagcgccccaaagttgaccctcgcaatctccgcagtgcggaagaa
cagcgcgcccgcgaagcgaagctcggcaccgtcaccttcgtcgaaagtagtggtggcggt
ggcttcttcagcggtttgaccgctgccctgggtggtgcaggtgccgtgcggattccttcg
gggttccgaccaattaacgtggcgcgctatggcccgcgcaacatgcagaaatcattgcgc
gacatgagctggtttctgcgctacatcacctacgcgatcgtggcgggcgaccccaatatc
ttggttgtcaacgtccgcggtctgcgcgaaatcattgagaaagcttgctccacgcctgcg
acgctggtggctctacaggatatgcgggcgaccagtgccggctacttccgcaacgatcct
gaagcccagcaactggtcaaagactactttgacgtgctgattcgggagttcgaagccccg
actccatcgctgaagcagcgccagcgttttgctgaggatcaacagggactggcactgccc
caaagctatgccaacgcagctgaacggcgtcctaaatttgtgatcaagtcgaccctgtcg
accgttgagaagaatgaagcgatcaaagcggcctatcgccaagtctttgaacgggacatc
acccgcgcttacagccagaaggtttctgacctagaatccaaggttaaaaacggcgagatc
tcaaccaaagaatttatccgccgcttgggtaaatcaccgctctaccgtcagcaattccac
gatcgcttcgtcaatagccgcgtgatcgagctggccttccgccacttcttgggtcgcggc
atcagctctgctgaggagttcacccgctacttcgatctgctcagtgccaagggctttgca
gcattgatcgatgccttggtggattcgcaggaatacgcagactacttcggcgaagaaacc
gtgccttacctgcgcggtctgggtcaagaagcacaagagtgccgcaactggggcgttcag
caagagctgttcaaatacagcgcaccctttgtcaaagtgccgcagtttgtcactctgttt
ggggaatacaagcagcctctgctcgatcaacacccctacggtgctggcaacgacccgctg
gaaattcagttcggggccatcttcccctcacgcacggtcaacaaccgcaccaatccagcc
cccttcggcaaagatactcgtcgcttgctggtctccaagggcggcgtcaacaaccaagtg
ggcagcgccgctttccaacaaagtggcaccacgccaaccaagattttcaaactcacccaa
gtcgctgctggtagcagctcgatacgcagcaaatcggtcggcaatcccagtattcgccaa
accgaaagcaccactcaagccgtgattcgggccgcctatcggcaagtctttggccgcgac
ctctacgaaggtcagcgtctgacggtaccggaaatcaagctcgaaaacggtgaaatcacc
gtgcgggagtttgtgcgtcagatcgccaagtctgaaaccttccggaagctctactggaac
aacctctacgtcgtcaaagccgtggagtacatccatcgccgcttgctgggccgtcccacg
acgggtcgtgccgagattaacgcctacttcgacatctcagcgaagaaaggcttctatgcc
cttgtggatgcgattctcgacagtcccgagtacattgctgccttcggggaagatacggtg
ccctacgagcgctatatcacccccaaaggcttggctctgcgttctgtgcgtggcctagag
gcctctgagaaggtcaaagcgtcgctccgacccgctgctggggcccaggaacgccgtcca
gaggttggccgtcgctag

DBGET integrated database retrieval system