KEGG   Synechococcus elongatus PCC6301: syc1186_d
Entry
syc1186_d         CDS       T00163                                 

Gene name
apcA
Definition
(GenBank) allophycocyanin alpha chain
  KO
K02092  allophycocyanin alpha subunit
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc1186_d (apcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1186_d (apcA)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Allophycocyanin (AP)
    syc1186_d (apcA)
SSDB
Motif
Pfam: Phycobilisome
Other DBs
NCBI-ProteinID: BAD79376
CyanoBase: syc1186_d
CYORF: syc1186_d
UniProt: P06112
Structure
PDB: 
4F0U

Position
1297467..1297952
AA seq 161 aa
MSIVSKSIVNADAEARYLSPGELERIKTFVVGGDRRLRIAQTIAESRERIVKQAGNQLFQ
KRPDVVSPGGNAYGEDMTATCLRDLDYYLRLVTYGVVSGDITPIEEIGIVGVREMYKSLG
TPIEAVAEGVRELKSAATALLTGEDADEAGAYFDYVIGALS
NT seq 486 nt   +upstreamnt  +downstreamnt
atgagtatcgtctcgaagtccatcgtcaacgctgacgccgaggcgcgttacctaagccct
ggcgaactggaacgcatcaaaaccttcgttgtcggtggcgatcgtcgtctgcggattgcg
cagaccattgctgagtcccgcgagcggatcgtcaagcaagctggcaaccaacttttccaa
aagcgtcctgacgtggtttcgcccggtggcaatgcctacggtgaagacatgacggccacc
tgcctgcgtgacctcgactactacctgcgtcttgtgacctacggtgtagtttcgggcgac
atcaccccgattgaagaaatcggcattgtcggtgtccgcgaaatgtacaaatcgctagga
acccccatcgaagctgtcgctgaaggcgtccgtgagctgaaatcggctgcaaccgcccta
ctgactggtgaagacgctgacgaagcaggcgcttactttgactacgtaattggcgctctc
agctaa

DBGET integrated database retrieval system