KEGG   Synechococcus elongatus PCC6301: syc1188_d
Entry
syc1188_d         CDS       T00163                                 

Gene name
apcC
Definition
(GenBank) phycobilisome core component
  KO
K02094  phycobilisome core linker protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc1188_d (apcC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1188_d (apcC)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Allophycocyanin (AP)
    syc1188_d (apcC)
SSDB
Motif
Pfam: CpcD Slp
Other DBs
NCBI-ProteinID: BAD79378
CyanoBase: syc1188_d
CYORF: syc1188_d
UniProt: P06114
Position
1298586..1298789
AA seq 67 aa
MRMFRITACLPSPSKIRTQRELQNTFFTKLVPYDAWFREQQRIQKLGGKIIKVELATGRP
NTNTGLL
NT seq 204 nt   +upstreamnt  +downstreamnt
atgcggatgttccgaatcaccgcttgcttgcccagccccagcaaaatccggactcagcgc
gaactgcaaaacaccttctttacgaagctcgttccatacgatgcttggtttagagagcag
cagcgcatccaaaagctgggtggcaagatcatcaaggttgaattggcgactggccgtccg
aataccaataccggactgctctag

DBGET integrated database retrieval system