KEGG   Synechococcus elongatus PCC6301: syc1218_c
Entry
syc1218_c         CDS       T00163                                 

Gene name
psbO
Definition
(GenBank) photosystem II PsbO protein
  KO
K02716  photosystem II oxygen-evolving enhancer protein 1
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1218_c (psbO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1218_c (psbO)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc1218_c (psbO)
SSDB
Motif
Pfam: MSP
Other DBs
NCBI-ProteinID: BAD79408
CyanoBase: syc1218_c
CYORF: syc1218_c
UniProt: A0A0H3K2E2
Position
complement(1329657..1330490)
AA seq 277 aa
MRYRAFLAAFLAVCLGVLTACSSGPTAADLGTLTYDQIKDTGLANKCLSLKESARGTIPL
EAGKKYALTDLCLEPQEFFVKEEPGNKRQKAEFVPGKVLTRYTSSLDQVYGDLALKADGT
VSFTEKGGIDFQAITVLLPGGEEVPFLFTVKGLVASTSEPATSINTSTDLRGGYRVPSYR
TSNFLDPKARGLTTGYESAVAIPSAGDAEDLTKENVKRFVTGQGEISLAVSKVDGATGEV
AGVFTAIQPSDTDMGGKEAVDVKLVGQFYGRIEPADA
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcggtatcgcgcgtttctggctgcgtttttggcagtctgcctcggagttctgaccgcc
tgcagcagcggcccgacggcagcagatttgggcacactcacctacgaccaaatcaaagac
actggcttggccaacaagtgtctctccctgaaagaatccgctcggggcaccatccccttg
gaagcgggtaaaaaatatgctctgactgatctgtgcctagagccgcaagagttcttcgtg
aaagaagagccgggcaacaagcgccagaaagcagaattcgtgccgggcaaagtcttgacc
cgctacacctcgagcttggatcaggtctacggtgacttggccctgaaagcagacggcacc
gtcagctttaccgaaaaaggtggcattgatttccaagccatcacggttctgctccccggt
ggtgaagaggttcccttcctgttcacggtcaagggcttggtggcgagcaccagtgagccg
gcaaccagcattaacacctcgacggatctgcggggtggctatcgcgtgccttcttatcgc
acctcgaacttcctcgatcccaaagcgcgcggtctgaccacgggctacgaaagcgcagta
gcaattccttcggctggtgatgcagaagacctgacgaaagaaaacgtcaagcgtttcgtg
actggtcaaggggaaatttccttggctgtctcgaaagttgatggcgctacgggtgaagtg
gcgggcgtgttcaccgcgatccagccatccgacacggacatgggtggtaaagaagccgtc
gacgtcaaactcgtcggtcagttctacggccggattgaaccggctgacgcctag

DBGET integrated database retrieval system