KEGG   Synechococcus elongatus PCC6301: syc1529_c
Entry
syc1529_c         CDS       T00163                                 

Gene name
petF
Definition
(GenBank) ferredoxin petF-like protein
  KO
K02639  ferredoxin
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1529_c (petF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1529_c (petF)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosynthetic electron transport
   syc1529_c (petF)
SSDB
Motif
Pfam: Fer2 Zn_Tnp_IS91
Other DBs
NCBI-ProteinID: BAD79719
CyanoBase: syc1529_c
CYORF: syc1529_c
UniProt: A0A0H3K378
Position
complement(1649400..1649768)
AA seq 122 aa
MSDTYTVRIRDRRTDEEFTVQVPPDRYILQTAEEQGYELPFSCRNGACTACAVRVLGGAI
EQTEAMGLSAPLRQRGYALLCVSYPRSDVIVETQDEDEVYMLQFGRYFGQGKVSFGLPLD
EE
NT seq 369 nt   +upstreamnt  +downstreamnt
atgagcgacacttacaccgtccgcattcgcgatcgccgtaccgatgaggagtttacggtg
caggttccgcccgatcgctacatcctgcaaaccgccgaagagcaaggttatgagttaccg
ttctcctgccgcaatggggcttgcacagcctgtgcagtgcgcgttctcggcggcgcgatc
gagcaaaccgaggccatgggactctcagctccgctacgccagcgcggttatgccctgctc
tgcgttagctatccgcgatcggatgtgattgtggagacccaagacgaagacgaagtctac
atgctgcagtttggtcgctattttggccaaggaaaagtcagctttggcctgcccttggac
gaggaataa

DBGET integrated database retrieval system