KEGG   Synechococcus elongatus PCC6301: syc1568_d
Entry
syc1568_d         CDS       T00163                                 

Gene name
petJ
Definition
(GenBank) putative cytochrome C6-2
  KO
K08906  cytochrome c6
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1568_d (petJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1568_d (petJ)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosynthetic electron transport
   syc1568_d (petJ)
SSDB
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C Cytochrom_C550
Other DBs
NCBI-ProteinID: BAD79758
CyanoBase: syc1568_d
CYORF: syc1568_d
UniProt: A0A0H3K6K8
Position
1693061..1693408
AA seq 115 aa
MNRLLRSLLMAFCLLICGLTIAPISTQAAPATGAALFEAQCVGCHIGGGNIIRRGKTLQL
KALKKNGYDTAEAIATIVSQGKNNMSAYSDRLSPEEIAIVSAYVLEQANAGWPRS
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaccgtctgttgcgatcgctcctcatggctttttgcctgctgatttgtgggctgact
atcgctccaatttccactcaggctgcaccggcaactggagcagcgctcttcgaggcacag
tgcgttggttgccatattggcggcggcaatattattcgccggggcaaaaccctacaactc
aaagccctgaaaaaaaatggttacgacactgctgaagcgatcgcgacgatcgtcagccag
ggcaaaaacaacatgtccgcctacagcgatcgcctcagccccgaggaaattgcgatcgtt
tccgcctatgtgctggaacaagccaacgcgggctggcctcggtcataa

DBGET integrated database retrieval system