KEGG   Synechococcus elongatus PCC6301: syc1605_c
Entry
syc1605_c         CDS       T00163                                 

Gene name
aroF
Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01230  Biosynthesis of amino acids
syc02024  Quorum sensing
Module
syc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    syc1605_c (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    syc1605_c (aroF)
Enzymes [BR:syc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     syc1605_c (aroF)
SSDB
Motif
Pfam: DAHP_synth_1
Other DBs
NCBI-ProteinID: BAD79795
CyanoBase: syc1605_c
CYORF: syc1605_c
UniProt: A0A0H3K412
Position
complement(1733781..1734845)
AA seq 354 aa
MKQTSDLHVVETRSLISPAEIHQKLPLSETAADLVASTRDRVRSILRNSDRRLLVIVGPC
SIHDVNAAYDYGQKLLPLREELADELEIVMRVYFEKPRTTVGWKGLINDPHLDGSYDINT
GIQRARKLLLGLADMGLPAATELLDPIIPQYIADVIAWTAIGARTTESQTHREMASGLSM
PIGFKNGTDGSFHIAANAMLSASQPHHFLGINHDGLASIVSTTGNPDGHLVLRGGSKGPN
YAAADIEEAAYQLASMGLHARVMVDCSHGNSNKDYRRQSVVLSDLAEQVAEGSRHLMGVM
IESHLVEGNQPIPADLSELRYGQSITDPCVDFPTTEKMLRELARAQRGLVPSLA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaaacagacttccgatctccacgtcgtcgagacgcgttccttgatcagtcctgcggaa
attcaccagaagctgcccctttccgagacagcagcagacttggtggcttctacccgcgat
cgcgttcgtagcattttgcgcaatagcgatcgccgcctgttggtgattgtcgggccctgc
tccattcacgacgtcaacgcagcttacgactacggccaaaagctcttgccactgcgcgaa
gagctggcggatgaacttgaaatcgtgatgcgggtctactttgaaaagccccgcacgacg
gtcggctggaaaggattgatcaacgatccccacctcgacggcagctacgacatcaatacc
ggcatccagcgggctcgcaagttattgctcggtttggcagatatgggcttgcccgccgcg
acagaactgctcgacccgattattccgcagtacatcgctgatgtaattgcttggacggcg
attggggcgcgaaccaccgaaagtcaaactcaccgcgaaatggcttcgggcctgtcgatg
ccgatcggcttcaaaaatggcaccgatggtagcttccatatcgcagccaatgccatgctt
tccgccagccagccccaccatttcctgggaattaaccatgacggtctggccagcattgtc
tcgaccaccggcaatccagacggtcatttagtgctgcgcggcggcagcaaaggtccaaat
tacgcagcagcggacattgaagaagcagcctatcaactggctagcatgggcctccatgca
cgagtgatggtggactgcagccacggcaactccaacaaggactatcgccgtcagtcagtg
gtgctctcagatctggccgaacaggttgctgagggatcgcgtcacctgatgggcgtgatg
attgaaagccacctggttgaaggcaatcaacccatcccagccgacttgtcagagttgcgc
tacggccaaagcatcaccgatccctgcgtcgactttccgaccacagagaaaatgctgcgg
gagctagcccgagcccagcgcggcttagtcccgtccttggcttaa

DBGET integrated database retrieval system