KEGG   Synechococcus elongatus PCC6301: syc1611_d
Entry
syc1611_d         CDS       T00163                                 

Gene name
livH
Definition
(GenBank) integral membrane protein of the ABC-type Nat permease for neutral amino acids NatD
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc02010  ABC transporters
syc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:syc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    syc1611_d (livH)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    syc1611_d (livH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syc02000]
    syc1611_d (livH)
Transporters [BR:syc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    syc1611_d (livH)
SSDB
Motif
Pfam: BPD_transp_2 Pam17
Other DBs
NCBI-ProteinID: BAD79801
CyanoBase: syc1611_d
CYORF: syc1611_d
UniProt: A0A0H3K434
Position
1740097..1741038
AA seq 313 aa
MDWLQPLINGLAIGGVYALFALGYTLVFSILGVINFAHGAVFTLGAYLTYALVGGRFSFN
GLLANAALPFSLPFALALLLGSLLAGGASLLIEQVAFRPLRRRQADPLLTLISSLGVAVF
IVNLIQILVGAEIYTFPSNIYGDLPSAINLGSSDRPIQIRTVQIILFVVAIAMFSLLTWL
INGTRVGHALKAVAEDATTASLLGIDPDRYIRLTFFLSGVLGGLAGTLVGTSVSITGPYF
GIAYGLKGLSVMVLGGLGNIPGTIAGGLLLGLAEAWVPPQWSGYRDAVAFALLFAMLLIR
PQGLFSRARTEKV
NT seq 942 nt   +upstreamnt  +downstreamnt
atggattggttgcaaccgctgatcaatggtctggccatcgggggcgtctatgccctgttt
gccttggggtataccttggtcttttcgatcctgggggtcattaactttgcccatggtgcc
gtttttaccctcggtgcctacctgacttacgctctagtgggtgggcgtttcagcttcaac
gggttgctcgccaatgccgcgctgcccttcagtttgccgttcgccttggctctgctgctc
ggcagtttgctggccggcggtgccagcctcttgattgagcaagtggcctttcgtcccctg
cgccgccgccaagcggatcccctcctaaccctgatctccagccttggcgtggcggtgttt
atcgtcaatttgattcaaatcttggtgggagccgagatttacaccttcccaagcaacatc
tacggcgacctacccagtgccatcaacttaggcagcagcgatcgcccgatccagatccgc
acggtgcaaatcatcctgtttgtcgtggcgatcgcgatgttcagtctgctgacttggctg
atcaacggcacccgcgttggccatgccctgaaagctgttgccgaagatgccaccaccgct
agcctgctgggcatcgatcccgatcgctacatccggctgaccttcttcctgagtggcgtc
cttggtggtttggcgggcaccttggtcggtaccagtgtcagtatcaccggcccctatttc
gggattgcctacgggctgaaaggcctgagtgtgatggtcttaggtggactcggcaatatt
cccggcacgattgcgggcggcttgttgttgggtctggcggaagcttgggtgccgccacaa
tggtcgggctatcgcgatgccgttgcctttgcgctgctatttgccatgctcttgatccgt
ccccagggcttgtttagtcgtgctcggacagagaaggtgtag

DBGET integrated database retrieval system