KEGG   Synechococcus elongatus PCC6301: syc1626_d
Entry
syc1626_d         CDS       T00163                                 

Gene name
psb28
Definition
(GenBank) photosystem II reaction center W protein
  KO
K08904  photosystem II Psb28-2 protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1626_d (psb28)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1626_d (psb28)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    syc1626_d (psb28)
SSDB
Motif
Pfam: Psb28 CHGN
Other DBs
NCBI-ProteinID: BAD79816
CyanoBase: syc1626_d
CYORF: syc1626_d
UniProt: A0A0H3K3P2
Position
1756910..1757284
AA seq 124 aa
MTDVLPTIELFDGIAEELDNVSLRRDRQSGTRNVLLRFRALKALDRFNSFRSRFSKAIRL
TDSEGAIELWPDSSKLVFGGDDGDELDRVEFVVPIDNEDHWQRFMRFMERYAAANDMTYG
DRQA
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaccgacgtactgcccacgatcgaactgtttgatggcatcgctgaagaactcgataac
gtcagcttgcggcgcgatcgccaatccggcacccgcaatgtcttgctccgcttccgtgcc
ctcaaagcccttgatcgcttcaatagtttccgaagccgcttttccaaagcgattcgcctc
accgatagtgaaggggcaatcgaactttggcccgactcctccaagttggtgtttggcggt
gatgacggcgatgaactggaccgcgtcgagtttgtcgtcccgatcgacaatgaagaccac
tggcaacgcttcatgcgatttatggagcgctacgctgcggccaatgacatgacctacggc
gatcgccaggcataa

DBGET integrated database retrieval system