KEGG   Synechococcus elongatus PCC6301: syc1642_d
Entry
syc1642_d         CDS       T00163                                 

Gene name
xylB
Definition
(GenBank) probable sugar kinase
  KO
K22935  D-ribulokinase [EC:2.7.1.47]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00040  Pentose and glucuronate interconversions
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    syc1642_d (xylB)
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.47  D-ribulokinase
     syc1642_d (xylB)
SSDB
Motif
Pfam: FGGY_C FGGY_N
Other DBs
NCBI-ProteinID: BAD79832
CyanoBase: syc1642_d
CYORF: syc1642_d
UniProt: A0A0H3K6V0
Structure
PDB: 

Position
1772679..1773959
AA seq 426 aa
MVVALGLDFGTSGARAIACDFDSDRSVSVSVTFPKTSQNWPQVWREALWQLLTQIPADWR
SRIERIAIDGTSGTVLLCDREGQPQTEPLLYNQACPIGLADLADWVPADHAALSSTSSLA
KLWFWQQQFGALPPDWQILAQADWLSLQLHGCSQQSDYHNALKLGYSPDRERFSKNLLDS
ELGALLPVVHEPGVAIGPILPAIAQEFGLSPDCQICAGTTDSIAAFLASGAHQPGVAVTS
LGSTIVLKLLSQVAVSDRLTGVYSHKLGGYWLTGGASNCGGATLRQFFPDTELESLSCQI
DPTKKSGLDYYPLPSRGERFPIADPDRLPQLEPRPENPVQFLQGLLEGLAQVETLGYQRL
QDLGATPLKRIWTAGGGAKNAVWQQLRQQAIGVPIAIAPNTEAAFGTARLAAFGLAAFHS
AGLKRT
NT seq 1281 nt   +upstreamnt  +downstreamnt
gtggtcgttgcacttggcctcgacttcggcacctctggagcccgagcgatcgcctgtgat
tttgacagcgatcgctcggtttctgtatcggtcacttttcccaagaccagtcagaactgg
ccgcaagtttggcgtgaagcgctctggcagctcctcacacaaattcctgctgactggcga
tcgcggatcgagcgaattgcgattgatggtacgtccggcaccgtcttgctctgtgatcgc
gagggtcagccccagactgagccgctgctctacaaccaagcttgtcccattggtcttgcg
gatttagcagattgggttccggccgatcatgcagcgctgagttcgacttcttcgctggca
aaactctggttttggcaacagcagtttggtgcgttgcctccagactggcaaattctggct
caggcggattggctgtcgctccaactgcatggatgcagtcagcaaagcgactatcacaat
gccctcaagctggggtattcgcccgatcgcgagcgcttcagtaaaaatttgctggattca
gagctaggcgcgctcttaccagttgtccatgaaccaggagttgcgatcggtccgattctg
cccgcgatcgctcaagagtttggcctgtcgcctgactgtcagatttgtgccggtacaacg
gatagcattgctgcttttctcgcgagtggtgcccaccaacccggtgtagctgtgacttcc
ctcggttccacaattgttctgaaactgctgagtcaggtcgcagtcagcgatcgcctgacc
ggcgtttacagtcataaactcggcggctattggctcacgggcggtgcttccaactgcggt
ggcgcgaccctgcggcagttttttccggatacagaactcgaaagtctcagttgccaaatc
gatcccaccaaaaaaagcggacttgattactatccgctgcctagtcgaggtgaacggttc
ccgatcgctgatcctgatcggctgcctcagcttgaacctcggcctgagaatccagtccag
tttttgcaagggctgctggaaggactggcgcaagtggaaaccttgggctatcagcgtttg
caagacctcggcgcaacgcccctaaaacggatttggacagcgggtggtggggctaaaaat
gccgtttggcaacaactccgtcaacaagcgatcggtgttccaattgcgatcgcccccaat
acagaagcagcttttgggacagctcgactcgccgcctttggcttggctgcatttcactcg
gcggggttaaagagaacctga

DBGET integrated database retrieval system