KEGG   Synechococcus elongatus PCC6301: syc1648_c
Entry
syc1648_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: DUF4335
Other DBs
NCBI-ProteinID: BAD79838
CyanoBase: syc1648_c
CYORF: syc1648_c
UniProt: A0A0H3K6V7
Position
complement(1781660..1782610)
AA seq 316 aa
MQLQRLYQLPNCSLLVQGLADASLDNSQCLTIVTRVECGFPGLQPALRGGKDFLVQLATV
ASAYAQGVISGLPRPQTAISSDLIQLRSLDRDRHQLTSNDNGSEVALELNSLQLFDLVDA
IDQLIADPLTLPDLQIGLAPLPRRHVPALVPLPQRAAAPAVGLAGLAIAAAALFALPIPE
VKPPRENLPQTEQTTSGANSNPPATEPPASSPSLADAGTLEAVVVASRAAIGSAWDRKPE
YEPAEAEQYRVSATATGQIVGYRAEDSQSDIQQTPLASLLKPLPAGDRQPLADLRIVFQP
SGVVEVSPWDGWGSVR
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcaacttcaacggctctatcagctgcccaattgcagtttgctcgtgcaaggccttgcc
gatgccagcttggataacagtcaatgcctgacaattgtgacgcgggtggagtgtggcttc
cccggcctacaaccggctctacggggtggtaaagattttctggttcagcttgccacagtc
gcgagtgcctacgcccaaggggtgatcagtggtttgcctcgcccccagactgccatcagt
agcgacttgatccagttgcgatcgctcgatcgcgatcgccatcagctgaccagtaacgat
aacggtagcgaagttgcactggaactaaacagcctgcagctctttgatctggtcgatgcg
atcgatcaactcatcgcagaccccttaacgctgcccgatctccagattggcttggccccc
ctaccgcgtcgccatgtcccagctctggtgccgttgccacaacgggccgccgcacccgct
gtcggtctagctggactcgcgatcgctgctgcagctctctttgccctgccaattcctgag
gtgaagccgccgcgcgagaacctaccccagactgagcagacgacctcaggggcgaacagc
aatccacctgcgacagagcctcctgccagtagcccaagtttggcggatgcaggaacgctg
gaagctgttgtggtggccagtcgagcagcgatcggcagtgcttgggatcgcaaacccgag
tacgaacctgcggaagctgagcaatatcgcgtcagcgcaacggccacaggtcaaattgtg
ggttatcgcgccgaagatagccaatctgacattcagcaaacaccgctcgcttcactcttg
aagccattgcctgcaggcgatcgccaacccctagcggatctccgcatcgtctttcagccc
agtggcgtagtcgaggtcagcccttgggacggctggggctccgtgcgctag

DBGET integrated database retrieval system