KEGG   Synechococcus elongatus PCC6301: syc1680_d
Entry
syc1680_d         CDS       T00163                                 

Gene name
petM
Definition
(GenBank) cytochrome b6-f complex subunit PetM
  KO
K02643  cytochrome b6-f complex subunit 7
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00162  Cytochrome b6f complex
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1680_d (petM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1680_d (petM)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Cytochrome b6/f complex [OT]
   syc1680_d (petM)
SSDB
Motif
Pfam: PetM NADH_oxidored
Other DBs
NCBI-ProteinID: BAD79870
CyanoBase: syc1680_d
CYORF: syc1680_d
UniProt: Q5N1F0
Position
1818134..1818247
AA seq 37 aa
MAGEIFGTAFLFIVLVPVGLALGAFLLKVQGVQKAEK
NT seq 114 nt   +upstreamnt  +downstreamnt
atggccggagaaatctttggaaccgcgtttctcttcatcgtgttggtgcccgtaggcttg
gcactgggagccttcctgctgaaagtgcaaggcgttcaaaaagccgaaaaataa

DBGET integrated database retrieval system