KEGG   Synechococcus elongatus PCC6301: syc1696_d
Entry
syc1696_d         CDS       T00163                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00230  Purine metabolism
syc00250  Alanine, aspartate and glutamate metabolism
syc01100  Metabolic pathways
syc01240  Biosynthesis of cofactors
Module
syc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    syc1696_d (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    syc1696_d (purA)
Enzymes [BR:syc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     syc1696_d (purA)
SSDB
Motif
Pfam: Adenylsucc_synt
Other DBs
NCBI-ProteinID: BAD79886
CyanoBase: syc1696_d
CYORF: syc1696_d
UniProt: Q5N1D4
Position
1834222..1835556
AA seq 444 aa
MANVVVIGAQWGDEGKGKITDLLSRSADVVVRYQGGVNAGHTVVVGEQTLKLHLIPSGIL
YPDTQCIIGSGTVIDPKVLLGEVEMLEQLGISTDHLLISQTAHVTMPYHRLIDQASEQQR
GSHKIGTTGRGIGPTYADKSERTGIRILDLMDPEGLREQLTWTIAQKNVILDKLYGLPPL
DAESVIEEYSGYAERLRPHVVDSSLTIDEAWRKRKNILFEGAQGTLLDLDHGTYPYVTSS
NPVAGGACIGAGVGPTIIDRVIGVAKAYTTRVGEGPFPTELHGDIGELLCQRGAEFGTTT
GRRRRCGWFDAVIGRYAVRINGIDCLAITKLDVLDDLDEIQVCVAYDIDGERCDHFPSSA
RSFANCQPIYKTVPGWKQSTSHCRNLEDLPKAALDYLKFLAELMEVPIAIVSLGASRDQT
IIVEDPIHGPKRALLHTNGDSSAS
NT seq 1335 nt   +upstreamnt  +downstreamnt
ttggcgaacgtagtcgtaatcggggcccagtggggcgacgagggcaaaggcaaaatcact
gacctgctcagccggtcagcagatgtcgttgtccgctatcaggggggcgtcaacgcgggt
cataccgtggtggtgggcgagcaaaccctgaagctgcatctgatcccctcaggcattctt
taccccgacacccaatgcatcattggttcgggcaccgtcattgaccccaaggtccttctg
ggcgaggtcgagatgctggagcagctagggatctccaccgatcacctgctgatttcccaa
accgcccatgtgacgatgccctaccatcgcttgatcgatcaagcatcggagcaacaacgg
ggcagtcataagatcggcaccaccggccggggcattgggcctacctatgccgacaaatcg
gagcgaaccggcattcgcattctggacctgatggatcccgaaggcttgcgggaacagctt
acttggacgatcgcccagaaaaacgtcattctcgacaagctctacggcctaccgccgctc
gatgctgagagcgttatcgaagaatattcgggctatgcagagcggctgcgccctcacgtc
gtcgacagctcgttgacgatcgatgaagcgtggcgcaagcgcaaaaacattctgtttgaa
ggcgcgcaaggtaccctgctcgacctcgaccacggcacctatccctacgtcacctcctcc
aatcccgtggcgggaggtgcttgtattggcgcgggcgttggccccacgattattgaccgt
gtgattggggtggcgaaagcctacacgacccgcgttggggaaggccctttcccgacagaa
ctccacggcgacatcggcgaattgctctgtcagcgcggggctgaatttgggacgaccacc
ggtcgtcgacgccgctgcggctggtttgatgcggtgatcggtcgttacgcggtgcggatt
aacggtattgactgtctggcgatcaccaagctcgatgtcttggatgatctggatgaaatt
caggtctgtgttgcttacgacatcgatggcgagcgctgcgaccatttccccagtagtgcc
cgtagttttgccaactgccagccgatctacaaaacggtgccgggttggaagcaatcgacg
tctcactgccgtaacttggaagacctgcccaaagctgccctggattatctgaagttcctg
gcggaattgatggaagtcccgatcgcgatcgtctccttgggcgctagccgtgaccagacg
atcatcgtcgaagaccccatccatgggccgaagcgtgctttgctccacaccaacggcgac
agcagcgcgagctag

DBGET integrated database retrieval system