KEGG   Synechococcus elongatus PCC6301: syc1721_c
Entry
syc1721_c         CDS       T00163                                 

Gene name
nifJ
Definition
(GenBank) pyruvate flavodoxin oxidoreductase
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00010  Glycolysis / Gluconeogenesis
syc00020  Citrate cycle (TCA cycle)
syc00620  Pyruvate metabolism
syc00650  Butanoate metabolism
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01200  Carbon metabolism
Module
syc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc1721_c (nifJ)
   00020 Citrate cycle (TCA cycle)
    syc1721_c (nifJ)
   00620 Pyruvate metabolism
    syc1721_c (nifJ)
   00650 Butanoate metabolism
    syc1721_c (nifJ)
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     syc1721_c (nifJ)
    1.2.7.-  
     syc1721_c (nifJ)
SSDB
Motif
Pfam: POR_N POR EKR PFOR_II Fer4_16 Fer4 Fer4_7 Fer4_6 TPP_enzyme_C Fer4_21 Fer4_9 Fer4_2 Fer4_10 Fer4_17 Fer4_8 Transketolase_C Fer4_3 Fer4_18 Fer4_4 Fer4_15 Fer4_13
Other DBs
NCBI-ProteinID: BAD79911
CyanoBase: syc1721_c
CYORF: syc1721_c
UniProt: A0A0H3K3L7
Position
complement(1862053..1865643)
AA seq 1196 aa
MASSPVYATLDGNEAVARVAYRLSEVIAIYPITPASPMGEWADAWAATHRPNLWGDVPSI
VEMQSEAGAAGAVHGALQVGALTTTFTASQGLLLMIPNLYKIAGELTPMALHIAARSLAA
QGLSIFGDHSDVMAVRGTGCALLCSASVQEAQDFAAIALRASLQSRIPFLHFFDGFRTSH
EIQKIALLPDEVLQQYIPAEAIREHRHRALSPDHPVIRGTAQNPDVYFQARETVNRYYNA
APALVQAAMDEFAQLTGRAYELVDYVGAPDAERAIVVMGSGAEVAEQTVLALQAQGEKVG
VLKLRLYRPFPAAELRQALPATVKAIAVLDRCKEPGASGEPLYLDVVEALSRLEQPPRVI
GGRYGLSSKEFTPAMTKAIFDHLSQTRLQHPFTIGIEDDVTHLSLPWDPSWSIEAADTVR
AIFYGLGSDGTVGANKNSIKIIGEDTDNWAQGYFVYDSKKSGSVTVSHLRFGPRAIAAPY
LIRQANFVACHQWQFLHSFDLIDSAAPHATLLINSPYSPEETWQQLPEKVQQGILDKQLQ
PWVINADALAAEQGLGRHINTVMQVAFFALSGVLPQDTAIAAYRRAVQKTYGKKGQAVVD
ANLAIIEPTLAALKPLPIGIPVAVGVTETPAIASAPPFVRDVLGAMLARKGDQLPVSALP
VDGTYPSGTSCYEKRNISDTVPVWEPDLCVQCGKCLLVCPHGVIRAKVYESEVLEAAPET
FKHAPARDATWSDRPFTIQVSTEDCTGCQLCVEVCPARDRQQPRRKALNMAAQAPLREAE
RHNWDFFLSLPEVDRSALNLHKIGQQQLQQPLFEFSGACAGCGETPYLKLMTQLFGDRLL
VANATGCSSIYSGNLPTTPWTHNAEGRGPAWSNSLFEDNAEFGLGFRVALDQQEAMAQQL
LSHLAAIAGSPLSPELVQQTLNADQSSEAGIFEQRDRVQQLKQQVQDWLSQEPDASVSDR
LNRWLDLADTLVRKSVWLVGGDGWAYDIGFGGLDHVLASGRNVNILVLDTEVYSNTGGQM
SKSTPRAAVAKFAAGGKPSAKKDLGLIAMTYGSAYVASVALGARDEHTIRTFIEAESYPG
PSLIIAYSHCIAHGIDMTKGLDAQKRAVDSGRWLLYRYDPRRRDRGDNTLQLDSRSPHLP
LSQALYSENRFQMLRLSQPEAAQQLLDQAQADVDQRWQFYQALAKPTPKPTAGGPQ
NT seq 3591 nt   +upstreamnt  +downstreamnt
atggcctcctctcctgtctacgccaccttagacggcaatgaagcggtggcaagggttgcc
tatcgcctcagcgaagttatcgccatctatccgattacgcccgcttcacccatgggcgaa
tgggctgatgcttgggcagccactcaccgaccgaatctttggggcgacgtgcccagcatt
gtcgaaatgcagagtgaggctggagcagccggagcggtgcatggagcgctgcaagtcggg
gcactgacgacgactttcacggcgtcccagggcttgctgttgatgatccccaatctctac
aagattgcgggcgaactgacgccgatggcgttacatattgcggcgcgatcgctggcggcg
caggggctttcgatctttggcgaccacagcgatgtgatggcggtgcgggggacaggctgt
gcgttgctctgttcagcctccgtgcaagaggcgcaagattttgccgcgatcgccctgcgg
gccagtctgcaaagccggattcctttcctgcactttttcgacggattccgcacctcccac
gaaatccagaagattgcgctgctaccagatgaggtgctgcagcaatacattcccgctgag
gcgattcgtgagcatcgtcaccgtgctctcagccctgaccatccggtgattcgcggcacc
gctcagaatcccgatgtctatttccaagcccgcgagacggtcaatcgctactacaacgca
gctcctgccctcgtccaagcggcgatggatgagttcgcgcagctgacgggtcgcgcttac
gaactggtggactacgttggtgctcccgatgcggagcgggcgatcgtggtgatgggttcc
ggcgcagaagtcgctgagcagaccgtccttgcactgcaagcccaaggcgaaaaagtcggg
gtgctgaagctgcggctctatcgaccattcccagcagcggaattgcggcaggctttaccc
gcaacagtcaaggcgatcgccgtcctcgatcgctgcaaggaacctggcgccagtggcgaa
ccgctctatctggatgtcgtcgaagcgctgtcacggctggaacaaccgccccgcgttatc
ggcggtcgctatggcctctcatcgaaagaatttacgccagcgatgaccaaggcaatcttt
gatcacctcagccaaacgcgattgcagcatcccttcacgatcgggattgaggacgatgtg
acccatctctcgctgccgtgggatcccagttggtcgatcgaagccgccgacacagtgcgg
gcgattttctacggtctcggctcggatggcaccgtcggggcgaataaaaactcgatcaag
atcattggcgaggacaccgacaactgggcgcagggctacttcgtctacgactcgaagaaa
tccggttcggtcacggtctcgcacctgcgctttggacctcgcgcgatcgcagcaccctac
ctgattaggcaggccaactttgtcgcctgccaccaatggcaattcctgcacagcttcgac
ctaatcgacagcgccgctccccatgccacgctgctgatcaacagcccctacagccccgag
gagacctggcagcaactcccagaaaaagtgcagcagggcatcctcgacaagcaactgcag
ccttgggtgatcaacgcggatgctttagcggcggagcaaggactgggtcgccacatcaac
acggtgatgcaggttgccttctttgcgttgtcgggtgtgttgccccaagacactgcgatc
gcagcctaccgccgcgctgtccagaaaacctacggtaagaaagggcaagccgttgttgat
gccaatctcgcgatcattgagccgaccttagcggccctcaagcccttaccgatcggcata
cccgttgccgtgggtgtaacggagactcccgcgatcgcatccgctccgccctttgtccgc
gatgtgctgggcgcgatgctggctcgcaaaggtgatcaactgccggttagtgcgctgccg
gtcgatggcacctatcccagcggcaccagctgctacgaaaaacgcaatatcagcgacacc
gtgccggtttgggagcccgacctctgtgtgcagtgcggcaaatgcctgctggtctgcccg
cacggtgtgattcgcgccaaagtctacgaatccgaggtactggaggcagcaccggagacg
ttcaagcacgctcccgctcgggatgccacttggagcgatcgccccttcacgattcaggtt
tcgaccgaagattgcactggctgccagctctgcgtggaagtctgccccgctcgcgatcgc
cagcaaccgcgccgcaaagccctgaatatggcggcgcaggcgccgttgcgcgaggctgag
cggcacaactgggactttttcttgagcctgccggaagttgatcgcagcgccttgaatttg
cacaaaattggccagcagcagttgcagcaaccgctgtttgaattttcgggcgcctgcgcg
ggctgcggcgaaacgccctacctgaagctgatgacgcaactgtttggcgatcgcctgttg
gtcgctaacgccacgggttgctcctcaatttacagcggcaatttgccaacgacgccttgg
acgcacaacgccgaggggcgcggccccgcttggtcgaattcgctgtttgaagacaacgcc
gagtttgggctgggtttccgtgtcgcgcttgatcaacaggaagccatggcgcagcagttg
ctcagccatctggcggcgatcgcgggcagtcctctctcgccagaactggtgcagcagaca
ctcaatgctgatcaaagcagtgaagccggtattttcgagcagcgcgatcgcgttcaacag
ctcaaacagcaagtgcaagactggctcagtcaggaaccggacgcatccgtgagcgatcgc
ctcaatcgctggctggatctggcggacacattggtgcgcaagagtgtctggctggtgggt
ggcgatggctgggcctacgacatcggctttggcggactcgatcacgtcctcgccagcggc
cgcaacgtcaatatcctcgtgctggatacggaggtttactccaacaccggcggccaaatg
tcgaagtcaacgccacgggcggcggtcgctaaatttgcggcaggtggcaaacccagcgcc
aagaaagacctcggcttaatcgcgatgacctacggctcggcttatgtggccagcgtggca
ctcggggcacgggacgagcacacgattcgcaccttcatcgaagccgagtcctatccgggg
ccgtcgctgatcattgcctactcccattgcatcgcccacggcatcgacatgaccaaaggc
ttggatgcgcagaaacgagccgtcgattccggtcgctggttgctctatcgctacgatccg
cgccgccgcgatcgcggtgataacacactgcaactcgattcgcgatcgccccatctaccg
ctgtcgcaagcgctctattccgaaaatcgcttccagatgctgcgtctcagtcagccagaa
gccgcgcaacaactactcgaccaagcacaggccgatgtggatcagcgctggcagttctat
caagcactggcgaaaccaaccccgaaacccacggcaggagggcctcagtaa

DBGET integrated database retrieval system