KEGG   Synechococcus elongatus PCC6301: syc1723_d
Entry
syc1723_d         CDS       T00163                                 

Gene name
hemN
Definition
(GenBank) oxygen independent coprophorphyrinogen III oxidase
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Radical_SAM HemN_C
Other DBs
NCBI-ProteinID: BAD79913
CyanoBase: syc1723_d
CYORF: syc1723_d
UniProt: A0A0H3K741
Position
1866958..1868148
AA seq 396 aa
MINLPIAAYLHIPFCRRRCFYCDFPISVVGDRLRGDQSGMIRQYVDAICQEIAATPVLGP
ALQTVFFGGGTPSLLSPNQLDRILQTLDRRFGIAATAEISIEMDPASFDRSQAIATRQLG
FNRVSIGAQAFQDGLLERCGRTHRRADIDRAVADLRAAGFENLSLDLISGLPEQTLADWQ
ASLEAAIALEPTHLSAYDLVLEPETVFGKRYQPGDRPLPADEQTAVMYRLAHRTLEAAGF
EHYEISNYARSGFQCRHNRVYWQDQSFYGFGVGATSALQGQRFGRPRRRADYFIWLETPG
AIAAACAPVTSDPADALAETLMLGLRLAEGLDWTALEQPFGAEILRSLQPVIQRYQQAGW
LQWQGDRLSLTQPEGMLFSNQVLASLFERLEAIATV
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgatcaatttgccgattgctgcttacctacacatccccttttgtcgtcgtcgctgcttt
tactgtgacttcccgattagcgtcgtgggcgatcgcctgcgcggggatcagtccggcatg
atccgccagtatgtggacgcgatctgccaagaaattgctgcgacgcctgtgcttgggcca
gcactgcaaacggtctttttcggtgggggaacgccctccctgctgagtcccaatcagctc
gatcgcattctgcagaccctcgatcgccgttttgggattgcagcgacggctgaaatttca
atcgaaatggatcccgctagctttgaccgatcgcaagcgatcgcaacgcgacagctaggc
tttaaccgcgtcagtattggcgctcaggcgtttcaagatggcctgttggaacggtgtggt
cgtacccatcggcgggccgatatcgatcgcgctgtggcggatttgcgggctgctggtttc
gagaatctcagtctggatttgatctcgggtctaccggaacagacgctggcggattggcag
gcttcattagaagccgcgatcgccctagaaccgactcacctctcggcctacgatctggtg
ctagaaccagagacggtgtttggcaagcgctatcaaccgggcgatcgccccttgccagcc
gatgagcaaaccgctgtcatgtatcgactggcgcataggaccttggaagcggcgggcttt
gagcactatgaaatctcgaactatgcgcgatcgggatttcagtgtcgccacaatcgcgtc
tactggcaggatcagtccttctatggctttggggtcggtgcgacgagtgccctgcaaggc
cagcggtttggccgtccgcgccgccgagctgattactttatctggctcgagacgccgggt
gcgatcgcggcagcttgtgcaccggttacctctgatccggctgatgccttagcggaaacg
ctgatgttggggctgcggctggcggaagggttggattggaccgcattagagcagccgttt
ggggcagaaatcctgcgatcgctgcaacctgtgattcagcgctaccaacaggcgggctgg
ttgcaatggcagggcgatcgcctcagcttgacccagccggagggcatgctcttctcgaat
caggtcttagccagtttgtttgaacgactcgaggcgatcgcgactgtctag

DBGET integrated database retrieval system