KEGG   Synechococcus elongatus PCC6301: syc1724_c
Entry
syc1724_c         CDS       T00163                                 

Gene name
panB
Definition
(GenBank) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00770  Pantothenate and CoA biosynthesis
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    syc1724_c (panB)
Enzymes [BR:syc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     syc1724_c (panB)
SSDB
Motif
Pfam: Pantoate_transf PEP_mutase
Other DBs
NCBI-ProteinID: BAD79914
CyanoBase: syc1724_c
CYORF: syc1724_c
UniProt: Q5N1A6
Position
complement(1868145..1868951)
AA seq 268 aa
MPITPRHLRQWKQQGRPIVALTAWDFAIASILDEAGIDLVLVGDSLAMVALGHPTTLPLS
LEDMIHHVQAVQRGCRNALIVSDLPFLSYQTSPEDAILAAGQLLKVTEAQAVKLEGGYPR
LLETVQRLVEVGIPVMGHVGLTPQSVRQLGYRQQGQTPEAQQQILDQALALEAAGAFAIV
LEHIPDRLAAMITAKLSIPTIGIGAGPNCDGQILVTADLLGLTPSQPPFAPAYLNLRQAI
GSAVQRYAREVRDRQFLQSQPAEQEPLS
NT seq 807 nt   +upstreamnt  +downstreamnt
atgccgatcacgcctcgtcacctgcgtcagtggaagcaacagggtcgcccgattgtggcg
ctgaccgcttgggattttgcgatcgccagcattttggatgaggcaggcatcgatctggtt
cttgttggcgattccttggcaatggttgccctcgggcatcccacgacgctgcccctaagc
ctagaagacatgattcaccatgtgcaggccgtgcagcgtggttgccgcaatgccctgatc
gtcagcgacttgccgtttttgtcctaccaaaccagcccagaagacgcgattctcgcagca
ggacaactgctgaaggtgacggaggctcaagccgtcaaattagaggggggctatccgcgc
ctcttagaaacggtgcaacgactggtggaagtcggcattccggtgatggggcatgtgggg
ctgactccgcaatccgtgcgccagctcggctatcgccagcagggacaaacgcccgaagcg
cagcagcagattttggatcaggctctcgcgctggaggctgctggcgcgttcgcgatcgtc
ttggaacacattcccgatcgccttgcagccatgatcacggcgaaactctcgattccaacg
atcgggattggggctggccctaattgtgatgggcaaattttggtgaccgccgatctgcta
ggactgacccctagccagccgccctttgcgccggcttatctcaacctgcggcaagcgatc
ggatctgccgtgcagcgttacgcccgagaagtgcgcgatcgccagttcctccagtctcag
ccagctgaacaggaaccactctcctag

DBGET integrated database retrieval system