KEGG   Synechococcus elongatus PCC6301: syc1725_dHelp
Entry
syc1725_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phasin FlxA MCPVI ZapB ATG16 Bap31_Bap29_C HR1 Apolipoprotein Dynamitin Golgin_A5 YtxH
Motif
Other DBs
NCBI-ProteinID: BAD79915
CyanoBase: syc1725_d
CYORF: syc1725_d
UniProt: A0A0H3K4C8
Position
1869255..1869683
Genome map
AA seq 142 aa AA seqDB search
MSTVTDLLQKAVYLGIGLASYVPELAKSENLSDLSDRVQKLVDDLVARGEMTTEEAKHAV
EDLVRQAQGSVNGPAGSPPPIPQPIQITVEEVEPEASSSAASTPADSAPSNNPASAADDL
ESLRQQVSQLREELNRLNQNKG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgttactgatcttctccaaaaagcggtctaccttggcatcgggctggcttcc
tatgtgcccgagttggcgaaaagcgaaaatctctcggatctgagcgatcgcgtccaaaaa
ttagtcgatgacttggtcgctcggggtgaaatgaccacggaagaagccaagcatgcggtt
gaagacttggtgagacaagcgcaaggctctgtcaatggtcccgctggatcgcccccgcct
atccctcagcccattcagatcacggttgaggaagtcgaacccgaggccagttcgagcgcg
gcctcaacgcctgccgacagtgcgccatctaacaatccagcttctgctgctgacgatctg
gaaagtctgcgtcagcaagtcagtcaactgcgagaagaattgaaccgcctcaatcagaac
aaaggataa

DBGET integrated database retrieval system