KEGG   Synechococcus elongatus PCC6301: syc1726_c
Entry
syc1726_c         CDS       T00163                                 

Gene name
thiD
Definition
(GenBank) phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00730  Thiamine metabolism
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    syc1726_c (thiD)
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     syc1726_c (thiD)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     syc1726_c (thiD)
SSDB
Motif
Pfam: Phos_pyr_kin PfkB HK Carb_kinase
Other DBs
NCBI-ProteinID: BAD79916
CyanoBase: syc1726_c
CYORF: syc1726_c
UniProt: A0A0H3KAN1
Position
complement(1869668..1870459)
AA seq 263 aa
MAVPIALTIAGSDSGGGAGIQADLRTFAFHQVHGTCAITCVTAQNTLGVTRVDAIAPAGV
AAQLDAVLSDLPPQALKTGMLLNAEIMEVVAGTIAPLFIPRIIDPVMVSRTGAVLIDQAA
IAVLRDHLLPLATVLTPNRYEAQLLAGMDIQDAADLDRAARIIRDLGPQAVLIKGGAATG
DWHGVDWWWDGQRSHILKTEAIATPHTHGSGCTLAAAIAANAALGLEILAAAQAAKHYVT
KALRHSLAIGQGQGPLGHFYPLF
NT seq 792 nt   +upstreamnt  +downstreamnt
gtggctgttccgatcgccctgaccattgccggatctgatagcggcggtggagctggcatt
caagccgatctacggacttttgccttccatcaagtgcacggcacctgtgcgattacctgt
gtgacggcccagaacacgctaggcgtgactcgagtcgatgcgatcgcaccggcaggtgtg
gcggcgcagctcgatgcggtgctttctgatttgccgccccaagccttgaaaaccggcatg
ctgctcaatgccgaaattatggaagtggttgctgggacaatcgcaccactcttcattcct
cggatcatcgatcccgtcatggtgtcgcgcacgggtgcagtgctgatcgatcaggctgcg
atcgctgtcctccgcgatcacctcttgccgctggcaaccgtcttgacccctaatcgctac
gaagctcagctactagccgggatggacatccaagacgctgctgatctcgatcgcgccgca
cggatcatccgagaccttggaccgcaagccgtgctgatcaaaggtggagcagcgaccggc
gactggcacggcgtcgattggtggtgggatggccaacgatcccacatcctaaagacggaa
gcgatcgccacaccccatacccacggcagtggctgcactttagccgccgcgatcgccgcc
aatgctgcgctggggcttgagattctagcagctgcccaagccgcaaaacactacgtcacc
aaagcactccgccacagcctcgcgatcggtcaaggacaaggcccgcttgggcatttttat
cctttgttctga

DBGET integrated database retrieval system