KEGG   Synechococcus elongatus PCC6301: syc1727_cHelp
Entry
syc1727_c         CDS       T00163                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:syc03036]
    syc1727_c (ftsZ)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:syc04812]
    syc1727_c (ftsZ)
   02048 Prokaryotic defense system [BR:syc02048]
    syc1727_c (ftsZ)
Chromosome and associated proteins [BR:syc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    syc1727_c (ftsZ)
Cytoskeleton proteins [BR:syc04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   syc1727_c (ftsZ)
Prokaryotic defense system [BR:syc02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    syc1727_c (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10 MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: BAD79917
CyanoBase: syc1727_c
CYORF: syc1727_c
UniProt: A0A0H3K3M0
Position
complement(1870459..1871640)
Genome map
AA seq 393 aa AA seqDB search
MTDPMPINNSYGFNRDGSLSGFDALGQPEELIIPSSVARIKVIGVGGGGSNGVNRMISSD
VSGVEFWALNTDAQALLHSAAPKRMQLGQKLTRGLGAGGNPAIGMKAAEESREELIAALE
GADLVFITAGMGGGTGTGAAPIVAEVAKEVGALTVGIVTKPFTFEGRRRMKQAEEGTAAL
QSSVDTLITIPNDRLLHAISEQTPIQEAFRVADDILRQGVQGISDIITIPGLVNVDFADV
RAVMADAGSALMGIGSGSGKSRAREAAHAAISSPLLESSIEGARGVVFNITGGRDMTLHE
VNAAADAIYEVVDPEANIIFGAVIDDRLEGELRITVIATGFSTDRPNLNTISTSTSQPTS
QPSVSPNPASAPPASGGGLDIPAFLQRKIQNRP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccctatgccgatcaacaattcctatggcttcaaccgtgacggctctctgtcg
gggttcgatgcactagggcagccagaagaactaatcatccccagcagcgttgcccgcatc
aaggtaattggcgttggcggtggcggcagcaacggggtcaaccgcatgattagcagcgat
gtcagcggggttgaattttgggccctcaacactgatgctcaagctttgctccactctgca
gcccccaagcggatgcagttgggacagaaactaacgcgagggctaggcgcaggtggcaac
cctgcgatcggcatgaaagccgctgaagaatcgcgggaagaactaatcgccgccttggaa
ggggctgacctcgtctttatcacggcggggatgggcggtggaaccggcactggagctgcc
ccgatcgtggcagaagtcgccaaagaagtgggtgcgctgacggttgggattgtcaccaaa
cccttcaccttcgaagggcgtcgccgaatgaagcaggcggaagaaggaacagccgcactg
caaagctcagtcgacactttgatcactattcctaatgaccgcctactccacgccatatct
gagcagacgccgattcaagaagctttccgggtcgccgacgatattctccggcagggtgtg
caagggatttctgacatcatcacgatcccaggtctggtcaacgtcgactttgccgacgtt
cgcgccgtcatggccgatgctggatcagccctgatgggcatcggtagcggctctggcaag
tcccgcgctcgggaagccgctcatgcagccattagctcaccgctgctggagtcttcgatc
gaaggggcgcgcggcgttgtcttcaacatcacaggcggccgcgatatgaccctgcatgag
gtcaacgcagcagcggatgcgatttacgaagtcgtcgatcctgaagccaatatcattttc
ggcgccgtgattgacgatcgattggaaggagagctgcggatcaccgtgatcgccacgggc
ttcagcaccgatcgccccaacctcaacacgatttccaccagcacgtcccagccgaccagc
caacccagcgtgagtcccaacccagctagtgccccaccggcgagcggcggcggcctcgac
attccggccttcctacaacggaaaattcaaaaccgaccctag

DBGET integrated database retrieval system