KEGG   Synechococcus elongatus PCC6301: syc1728_cHelp
Entry
syc1728_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K03589  cell division protein FtsQ
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:syc03036]
    syc1728_c
Chromosome and associated proteins [BR:syc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    syc1728_c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POTRA_1 DUF998
Motif
Other DBs
NCBI-ProteinID: BAD79918
CyanoBase: syc1728_c
CYORF: syc1728_c
UniProt: A0A0H3K3Y4
Position
complement(1871860..1872714)
Genome map
AA seq 284 aa AA seqDB search
MVMADLPEVASPASLAARRRQKRWERRRQRLQRFWRFVGVTAIAAGLVWVLARPLWIIQD
PRRIQIQGQQTLNRDRLLATLNLQMPLNLLQLQPQRLEQQLLKAAPLQAVQIQRRLLPAS
LIITVQEITATAQASRVVVEPNQPPQERWGILDRQGVWHPLSAYERLGATLPTTTLKVRG
YREPYQRLWPGLYSLLRTSPVGIQGLDWRDPANIILETELGPVYCGPYNPELLPQQIAML
DRLRQLPDKTSRSAIAYIDLRQPSTPRVQMKPSAPPRSLQTNPR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatggccgacttgcccgaagttgcttctccggcttcgttagccgctcgccgtcgc
caaaagcgttgggaaagacggcgacaacggctgcagcgcttctggcgttttgtgggggtg
acagcgatcgccgcaggtttggtctgggtgctggcccgtccgctctggatcatccaagat
ccacggcgcattcaaatccaaggccagcaaaccctcaaccgcgatcgcctcttggccacc
ctcaatctgcagatgcccctcaatctgctccagctgcagccccaacgcttagaacaacaa
ttactgaaagccgcccctctgcaagcggttcaaattcagcgccgtctcctgccagccagc
ctaatcatcaccgtccaagaaattaccgctactgcccaggcttcgcgggtggtcgtcgaa
cccaatcagccgccacaggagcgctggggcattctcgatcgccaaggcgtttggcatccg
ctcagcgcctacgaacggctgggggcaaccctgcccaccaccaccctcaaagtgcgtggc
taccgcgaaccctatcaacggctgtggcctgggctctattctctgttgcgcaccagcccg
gttggcatccaagggctcgattggcgcgatcctgccaacatcattttggaaaccgagctt
gggccggtttactgtggcccctacaatcccgagttacttccccagcaaattgccatgctc
gatcgcctgcgacaacttccagataaaaccagtcgctctgcgatcgcctacatcgatctg
cgccaaccttcaacaccccgcgtgcaaatgaagccttcagccccaccgcgatcgctccaa
accaaccctcgctaa

DBGET integrated database retrieval system