KEGG   Synechococcus elongatus PCC6301: syc1729_cHelp
Entry
syc1729_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAD79919
CyanoBase: syc1729_c
CYORF: syc1729_c
UniProt: A0A0H3K747
Position
complement(1872733..1873143)
Genome map
AA seq 136 aa AA seqDB search
MLHGLLWLPLLVLFTGLAWAGWNEYQKLESYKVWAADFETAKYDVRAVLGVRGSDLVWGK
PSRQGPVFLETIDLGTLQRIQVQQQNQLLSDPEASVNGSADLLLELRDRQIAIPFTEASL
ALKWRQFLNQRLGLSA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatgggttgctctggttgccgctgctagtgctgttcaccggcttggcttgggcc
ggttggaatgaatatcagaagctggagtcctacaaagtttgggctgccgactttgaaacc
gccaagtatgatgtgcgtgctgttctaggagttcgtggttccgatttggtctggggtaaa
cccagccgacaagggcccgtctttctggaaacgatcgatttgggaacgctgcaacggatt
caggtgcaacagcaaaatcagttgttgtctgatcctgaggcatcggtcaatggctcggcg
gatctcttgctggaactgcgcgatcgccaaattgccattccctttaccgaggcgagtctc
gcactgaagtggcgtcaatttctgaatcaacgtctgggcctcagcgcctaa

DBGET integrated database retrieval system