KEGG   Synechococcus elongatus PCC6301: syc1732_d
Entry
syc1732_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K19802  L-Ala-D/L-Glu epimerase [EC:5.1.1.20]
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    syc1732_d
Enzymes [BR:syc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.20  L-Ala-D/L-Glu epimerase
     syc1732_d
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N FMN_red Enolase_like_N
Other DBs
NCBI-ProteinID: BAD79922
CyanoBase: syc1732_d
CYORF: syc1732_d
UniProt: A0A0H3K4D1
Position
1875654..1876688
AA seq 344 aa
MQLSFEPFTVHKRFALRISRGSTQATTNLWVRLQQDGLEGWGEASPFSTGQQSQTTELLS
EALTTIAPALVHLDPWNHQQFEDLTRSLPSAARAALDLAIWDWRGKALGQPLWKLWGLAR
DRCPVTSVTIGISSPQAGQERLAAWRELFEPALIKVKLGSPEGVEADRVLLNALKEVAPT
TPFSVDANGGWDVATTRSLADWLVESGVIYLEQPLAKGQEADLLQLRDLPLPVFVDESAW
TSQDVAALSDRVDGINLKLLKTGGLTEALRAIHTARAHGLQLMLGCYSDSSLLNSAAAQL
GPLVDYLDLDSHLNLLDDPFNGATIAAGRLVPSDRPGLGVLRQE
NT seq 1035 nt   +upstreamnt  +downstreamnt
gtgcaactttcgtttgagccgttcactgttcacaaacgctttgcgctgcgaattagtcgt
ggcagtacgcaggcgacgaccaatctctgggtgcgcctccagcaggatggccttgaaggc
tggggtgaagcctcgcccttttcgactggtcagcagtcacagaccacggaattgctcagt
gaagcgctgactacgatcgctccggctctggtgcatctcgatccctggaatcatcagcag
tttgaggatctgacgcgatcgctgccttccgccgctagagctgctctcgatttagcgata
tgggattggcgcggtaaagcgctggggcagccactctggaaactgtggggactcgctcgc
gatcgctgtccggtcacgtccgtcacgatcggtattagttcaccgcaagcaggacaggaa
cgtcttgccgcttggcgagaactattcgagccagcgctaatcaaggttaagctgggtagt
cccgaaggcgttgaagccgatcgcgtcctgctcaatgctctgaaagaagtggcgccgacc
acaccttttagtgtcgatgctaatggcggctgggatgtggcaaccacgcgatcgctggcg
gattggttagttgagtccggtgttatttacttggagcaaccgctcgcaaagggtcaggaa
gcggatctgctacagctgcgcgatctaccactgccggtcttcgtcgatgaaagtgcttgg
acgagtcaggatgtggcggccttgagcgatcgcgttgatgggatcaatctcaaattgttg
aaaactggcggcctcacagaagcgctgcgagccattcatacagcgcgcgcacatggcctg
cagttgatgctgggctgctattccgacagcagtttgctcaatagtgcggcggcgcagttg
gggccgctggtcgattacctcgacctcgacagtcacctgaatttactggacgatccgttc
aacggtgccacaatcgcagcggggcggttagtccctagcgatcgccccggtctgggtgtc
cttcggcaagagtaa

DBGET integrated database retrieval system