KEGG   Synechococcus elongatus PCC6301: syc1733_dHelp
Entry
syc1733_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1611 DUF1611_N
Motif
Other DBs
NCBI-ProteinID: BAD79923
CyanoBase: syc1733_d
CYORF: syc1733_d
UniProt: A0A0H3KAN7
Position
1876691..1877740
Genome map
AA seq 349 aa AA seqDB search
MLQPEHRLAVLLHGGILGDSGKTGLTLLRYRQGAIAAVIDHETAGQDFQQLTGIARSLPI
YGSVAEAIAATEIDVLAIGIAPSGGKLPEAWLAEIDQAVQAGLSIANGLHTPLLLRYQAQ
LQPQQWIWDIRQEPAGLAIGGGRARSLTAQRILTVGTDMSVGKMSATLELDRAAQAKGLR
SAFVGTGQAGILISGQGVPLDAVRVDFASGAVEQAVLTAAEQVDYVWIEGQGSLLHPGST
ATLPLLRGSQPTHLVLVHRLGQTHNRHFPEFIIPPLTEVIQLYESLAAASGIFGRPKVAA
IALNGGQASDETVADAADQISQETGLPCTDVVRFGAANLLTTILEARDS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaacccgagcatcgactagcagtgctgctacatggcggcattctgggggacagt
ggtaaaacggggctgaccctgctgcgctaccgtcagggcgcgatcgcagcggtgattgat
cacgagacggcgggacaggatttccaacaactgacgggtattgcgcgatcgctgccgatc
tatggatctgtggcagaggcgatcgcagcgacggaaattgatgtcctcgcgatcgggatt
gccccatccggtggcaagcttccagaggcctggctggcagaaattgatcaggccgtacaa
gccggtctatcgatcgccaatggactacatacgccactactgctgcgctatcaagcacaa
ctgcagccccagcaatggatttgggacattcgccaagaaccagcagggctggcgatcggt
ggcggaagagcgcgatcgctaaccgctcagcgcattctgacggttgggactgatatgagc
gtcggtaagatgtccgccacgctcgaactcgatcgcgcggctcaagcaaaaggactgcga
tcggcttttgttggcaccggacaagcgggcattttgatcagcggccaaggcgtgccactg
gatgcggtgcgtgtcgattttgcctctggcgcggtcgagcaagcagtcctgacagcagca
gaacaggtggattatgtctggatagaaggccaaggctcactgctccatccgggttcaacg
gcaacgctgcccttactgcgtggcagtcagccaactcatctggtgctggtgcatcggctg
ggacagacccacaatcgccactttcccgagttcataattccgcctctaactgaagtgatt
cagctctacgaatcgctggcggccgcatctggtatcttcggcagacccaaggttgcggcg
atcgcgctcaatgggggtcaggctagtgatgagactgttgcagacgctgccgaccagatc
agccaagaaactggcttgccctgtacagatgtggtgcggtttggtgccgcaaacttgttg
acgacaatcctggaggctcgtgactcctga

DBGET integrated database retrieval system