KEGG   Synechococcus elongatus PCC6301: syc1734_d
Entry
syc1734_d         CDS       T00163                                 

Definition
(GenBank) acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine o-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00540  Lipopolysaccharide biosynthesis
syc01100  Metabolic pathways
syc01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    syc1734_d
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    syc1734_d
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:syc01005]
    syc1734_d
Enzymes [BR:syc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     syc1734_d
Lipopolysaccharide biosynthesis proteins [BR:syc01005]
 Lipid A
  syc1734_d
SSDB
Motif
Pfam: Hexapep Acetyltransf_11 Hexapep_2
Other DBs
NCBI-ProteinID: BAD79924
CyanoBase: syc1734_d
CYORF: syc1734_d
UniProt: A0A0H3K3M4
Position
1877781..1878575
AA seq 264 aa
MGIHPTAVIDPQAKLGQDVEIGPYAVVQGPVEVGDRCWLGPHSVVMGNLQLGTDCRVHSG
AVLGDWPQDLSFQGAESHVVIGDRNVFREGVTVHRGTKEGSVTTIGNDCLLMANSHVAHN
ASLGNNVILANGALIAGYAQVGDRAFISGNCLVHQFTRVGRLAMMSGGSAVQKDLPPFCM
TRSSTSNIVMGLNVVGLRRAGVSDRDRLELKRAFSILYRERLSFSEAIARLSADFHSPLV
TELQAFVSSSERGICRFLRSDLDA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgggcattcatcccaccgcagttattgatccccaagccaagctgggtcaggacgttgaa
attggtccctatgcggtggtgcagggccctgtcgaagtgggcgatcgctgttggctgggt
ccccactcggtggtaatgggcaacctgcagctcgggactgactgccgagttcacagtggt
gctgttctgggcgattggccgcaggatttatcctttcagggagcggaaagtcatgtggtg
atcggcgatcgcaatgtctttcgagaaggggtcacagttcaccgcggtacgaaagagggt
agtgtcaccacgattggcaatgattgcctgctgatggccaacagccatgttgcccacaat
gccagcctaggcaataacgtgattttggcgaacggggcattgattgcaggctatgcccaa
gtcggcgatcgcgcctttattagcggcaactgtcttgttcatcaattcactcgcgtcggg
cgtttggcgatgatgagtggcggctcagctgtccagaaagacctgccgcccttctgtatg
acccgcagctccaccagcaacattgttatgggcctgaatgtggttggtttacggcgggcg
ggtgtctccgatcgcgatcgccttgaactgaagcgagcctttagcatcctctaccgtgag
cggctgtccttttcagaagcgatcgctcgcctctcggcggactttcattcaccactggtg
acagaattacaggctttcgtcagcagctcagaacggggaatctgccgcttcctgcgatcg
gatctggatgcctag

DBGET integrated database retrieval system