KEGG   Synechococcus elongatus PCC6301: syc1735_cHelp
Entry
syc1735_c         CDS       T00163                                 

Gene name
acrF
Definition
(GenBank) RND multidrug efflux transporter
  KO
K03296  hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    syc1735_c (acrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF
Motif
Other DBs
NCBI-ProteinID: BAD79925
CyanoBase: syc1735_c
CYORF: syc1735_c
UniProt: A0A0H3K3Z1
Position
complement(1878816..1881986)
Genome map
AA seq 1056 aa AA seqDB search
MLLSIANIFIKRPVLTTVCSILITLGGLVCLPILPIEQLPDIAPPQIQVSATYVGADAET
VENTVTSILENQINGVEGMEYITSTSAIGQSSIQVYFDPTRSPDLAQVDVNNLVSVAIPQ
LPQAVQQQGIAVTQSSPSILQFYTFSSPTGEFDAQFISNYLSLYVQPALARVKGVGQANL
FGNLEYSMRLWLDPNRLASYGLTAEDVASALQSQNQIIPVGQVGGPPVNSDQAYTFILRL
QGQGQLSTVEQFNNVVLKTGEDGTLVRVKDVGRAEEGAQSYSVTLAADGRPGVGLGIYQL
PGSNAIDVANGIREQLAILEQQFPPGLEGKLVFDVTDFVNASLSEVLITLVQAIALVILV
IFIFLQDWRTTLIPAIAIPVSLVGTLAFIQAFGFSINLLTLFGLVLATGLVVDDAIVVVE
AITEKIEEGKTPLQASIEAMDILFGAVIATSVVLFAVFIPVAFFPGATGRIYQQFALTLT
FTILISTFNALTFSPAMSALLLRPAKQQQGWLGKFFNLFNAGFDRVRIGYSKALAIIDRL
KFLVIGLFAAGLALTGWLFTTTPTGFVPTEDQGYFLGLIIGPEGAPLNYTQKVGQKIQSI
LETEPSVTSTAVISGFSFIGQGNNLGIYFASLKPWDERKAADQSAEAIVGRINQKLFEGI
SEAQVRTLLPPAIPGFAAYGGVQFLITDQTGGALSVSQFLESVNKIIGLARENPITRQTF
TPFTANSPQIEIDVDRDRLAALNIDFGEALQTLGSYMGGQYVNQITQFGRSYQVYIQADN
GFRATPQALTQIYVKSRDGATVPLSEFLTIRQQVGPLYITHYNLFRSIEVDSFAAPGTST
GQVIEGLKDAFQKANFQRFGNGLVGLAREEVSAGTLAPLIFGLGVVVVFLVLAALYESYV
DPLIILLTVPLAILGALVFLNLRGIPLDVYAQVGLVMLIGLASKNAILIVDYANEAVAKG
MGYTEAALEAAKLRFRPIVMTAISSLIGFFPLVIAQGAGAASRWSLGTVVFGGLLVATVL
SLLIVPANYVILKSITRRFFSKKRHDPETGQPELTS
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgttgctttcgatcgcaaatatctttatcaagcggccagtgttaacaacggtctgctcg
attctgattactctgggcggccttgtttgcttacccattttgcctattgagcaactccca
gatattgccccaccccaaatccaagtctcagcaacctatgttggggccgatgctgaaaca
gttgaaaacactgtcacttcaatccttgagaaccaaatcaacggggttgaggggatggaa
tacatcacctcaacgagtgcgatcggtcaaagctccatccaagtctattttgatccgacg
cgatcgcctgacctcgctcaggtcgacgttaataacttagtcagtgttgcgatcccacaa
ctgccccaagcagtacaacagcaggggattgcagtcacgcagtcatccccttcaattctc
cagttctatacgttttcttcgcctacaggcgaatttgatgcccagtttattagtaactat
ctcagtctctatgttcagccagcactcgcccgtgtaaaaggggttggtcaagcaaacctg
tttggtaacttagagtactctatgcgactctggctcgacccaaatcgcttggcgagctat
ggcttgaccgcagaagatgtcgccagtgctttacagagccaaaaccaaatcattccggtt
gggcaagttggcggtccgccagtcaatagcgatcaggcttacacattcattttgcgactg
caggggcaagggcaactctctacggttgagcaattcaataacgtcgttttaaaaaccggt
gaggacggcactctcgttcgagtcaaggatgtcggtcgagccgaggaaggtgcccaaagc
tattccgtgactctggctgcagatggtcgcccgggcgtcggtctcggtatttatcagctg
ccaggcagtaacgctattgatgtcgccaacggcattcgtgagcagcttgccattctagag
cagcagttcccaccaggcttggaagggaagctagtcttcgacgtcactgacttcgttaac
gcttcactgtcggaagtgctgatcaccctggttcaggcgatcgcactggttattctcgtc
atctttatctttttgcaagactggcgcaccacgctcattccagcgatcgcaattcctgtc
tcgctggttggtaccttggcttttattcaagcctttgggttttcgatcaacttgctgacc
ctctttggcttggtgttggccacgggcttggtggtggacgacgcgatcgtggtggttgaa
gcaatcacagaaaaaatagaagagggcaaaacaccgttgcaggcctccattgaggccatg
gatatcctctttggtgccgtcattgccacgtcagtcgttctgtttgctgtcttcattcct
gtggcttttttcccgggggcaactggacggatctatcagcagttcgcactgacgctcacg
tttacgatcctgatttcaaccttcaacgccctgaccttctcgcccgcgatgagcgctttg
ctgctccggccggccaaacagcagcagggttggttgggtaagtttttcaacctattcaat
gcaggctttgatcgggtgcgaatcggttactccaaagccttggctattatcgatcgcctc
aaatttctggtcatcggcctattcgccgctggtctggccctgacgggatggttgtttacg
acaacccccaccggctttgttcccacagaagaccagggttacttcctcggtttgatcatt
ggccccgaaggagccccccttaactacacccagaaagtcggccaaaaaattcaaagcatt
ctggagactgagccttctgtcacctcaacggctgtgatcagcggctttagcttcattgga
cagggcaataacctcggaatctatttcgcatcgctcaagccctgggatgagcgcaaggct
gccgatcaatctgcagaagcgatcgtgggtcgaatcaaccaaaagttatttgaagggatt
tctgaagctcaagttcggactctgttgccacctgcaattcccggctttgcagcctacggc
ggggtgcagttcctcatcacagaccaaacgggcggcgcgctctctgtcagccagttttta
gagtctgtcaacaaaatcattggactcgctcgcgagaatccgatcacccgccaaaccttt
acacccttcacggccaactcgccccagatcgaaattgacgtcgatcgcgacagactggca
gccctcaacatcgacttcggtgaagcgctccagaccttgggcagctacatgggcggtcag
tatgtcaaccagatcacccagttcggccgctcctatcaggtctatatccaagcggataac
ggcttccgagcaacacctcaagccctgactcagatttatgtgaagtcgcgagatggagcc
acagttcccctctctgaatttctgacgattcggcagcaggttgggccactgtacatcact
cactacaaccttttccgttcgatcgaagtcgatagctttgcggctcccggcaccagtacc
ggtcaggtcattgaaggtctgaaagatgccttccagaaagcaaacttccagcggtttgga
aacggcctggttggtctggcccgcgaagaagtctctgcaggaacgttggcacccctgatc
tttggccttggggtggtggtcgtcttcctcgtcttggcggcgctctacgagagctacgtc
gacccactgatcattctgctgaccgttcccttggcaatcttgggcgccctcgtcttcctc
aacctgcggggcatccccttggacgtctatgctcaggtcggcttggtgatgctgattggc
ttggcttctaagaacgcgattttgattgttgactacgccaatgaggcggttgccaagggt
atgggctataccgaagcggcgctggaagcggcgaagctacggttccgcccgattgtaatg
acagctatttccagcttgattggcttctttcccttggtcattgcccagggggcaggcgcc
gctagtcgttggtcgctggggaccgtcgtctttggtgggctcttggttgcaacagttctc
agcttgctgatcgtgccggcgaactatgtgattctgaagtcgatcacccgacgtttcttt
agcaagaagcggcatgacccggagactggtcagcctgaattgacctcttag

DBGET integrated database retrieval system