KEGG   Synechococcus elongatus PCC6301: syc1741_c
Entry
syc1741_c         CDS       T00163                                 

Gene name
sds
Definition
(GenBank) solanesyl diphosphate synthase
  KO
K05356  all-trans-nonaprenyl-diphosphate synthase [EC:2.5.1.84 2.5.1.85]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00900  Terpenoid backbone biosynthesis
syc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    syc1741_c (sds)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:syc01006]
    syc1741_c (sds)
Enzymes [BR:syc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.84  all-trans-nonaprenyl diphosphate synthase [geranyl-diphosphate specific]
     syc1741_c (sds)
    2.5.1.85  all-trans-nonaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific]
     syc1741_c (sds)
Prenyltransferases [BR:syc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   syc1741_c (sds)
SSDB
Motif
Pfam: polyprenyl_synt HEPPP_synt_1
Other DBs
NCBI-ProteinID: BAD79931
CyanoBase: syc1741_c
CYORF: syc1741_c
UniProt: A0A0H3K3Z6
Position
complement(1887273..1888244)
AA seq 323 aa
MTSVTSLFAPVEADLQLLTDTLKQLIGARHPILYAAADHLFGAGGKRLRPAVVLLLSRAT
MPGQEITPRHRRLAEITEMIHTASLVHDDVVDESSLRRGIPTVHSSFSNRVAVLAGDFLF
AQASWHLAHLDSLTVVKLLSQVIMDLAEGEILQGLNRFDSSLSIEVYLDKSYYKTASLLA
NSARAASVLSGSSETVCDALYDYGRSLGLAFQIVDDILDFTGSEEVLGKPAGSDLASGNL
TAPALYAIEEHPALVPLIEREFSQAQDFEQAIALVHNSQGLARTRALAAEHAQKAVQALD
VLPASDCKETLISLTSYVLSRLS
NT seq 972 nt   +upstreamnt  +downstreamnt
atgacttcggtgacctcgctctttgcccccgtcgaggcggatctgcaactgctgactgac
acgctcaagcagttgatcggggcgagacatcctattctctacgccgccgctgaccatctc
ttcggagccggtggcaagcgacttcgtcctgcggtcgtgttgctgctctcgcgagccacg
atgcccggccaagaaattacgccacgccatcggcgcttggccgagatcaccgagatgatc
cacacggccagtttggtccacgatgacgtggtcgatgaatcctccctacgccgcggcatt
cccacagttcacagcagctttagtaatcgcgttgcagtcctcgccggtgacttcctgttc
gcccaagcttcttggcatttggcgcatctcgacagtctgacggtcgtcaagctcctgtct
caagtgatcatggatttggctgaaggcgagattctgcaagggctgaatcgctttgatagc
agcctctccattgaggtctacctcgacaagagctactacaaaactgcctctctcctcgcc
aacagtgctcgagcggcgagcgttctgagtggttcctcagaaaccgtctgcgacgcgctc
tatgactacggccgatcgctcggtctcgccttccaaatcgtcgatgacatcttagatttc
accggctcagaagaagtgcttggcaaacctgctggttcggacttggccagcggtaacctg
acggctccagccctctacgcgatcgaagagcatccggccttagtgcctttgattgaacga
gagttttcgcaggctcaggattttgaacaggcgatcgctttggtccacaacagtcagggt
ctagcccggactcgcgccttggccgcagaacatgcccagaaggccgttcaagccttggat
gtgctgcccgcttccgactgcaaggaaaccttgatcagcctgaccagctatgtcctcagc
cgcctctcttag

DBGET integrated database retrieval system