KEGG   Synechococcus elongatus PCC6301: syc1742_c
Entry
syc1742_c         CDS       T00163                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00471  D-Glutamine and D-glutamate metabolism
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    syc1742_c (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syc01011]
    syc1742_c (murI)
Enzymes [BR:syc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     syc1742_c (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:syc01011]
 Precursor biosynthesis
  Racemase
   syc1742_c (murI)
SSDB
Motif
Pfam: Asp_Glu_race CBP_GIL
Other DBs
NCBI-ProteinID: BAD79932
CyanoBase: syc1742_c
CYORF: syc1742_c
UniProt: A0A0H3K761
Position
complement(1888288..1889157)
AA seq 289 aa
MPPGAIFLHSSTAAPIGVFDSGVGGLTVLRELQRQLPHESFLYFGDTARLPYGTRSPAEI
RQFVREILDWMQAEGCKLVVMACNTSSALALEALRGDYTMPLIGLIQPAARVAVQRGQRI
GVIATAATAQSRAYRQALREANPNVQVWEIGCPEFVPLVEQQRIHDPQTLQVAAQYLAPL
IEAQVDTLIYGCTHYPHLAPVIQQLLPSSTHLLDPAEAVTRSVQMELEVLGLSHTSKAST
VRFCVSHDPQHFSLAIERWLGFQAPVDLIQLPTRSLPSAHFASEAEGVA
NT seq 870 nt   +upstreamnt  +downstreamnt
atgccgccgggggctatttttttgcattcttcaactgctgccccgatcggtgtgtttgac
agcggtgttgggggactcaccgtcctgcgcgagctgcagcgtcagctcccccacgaaagt
tttctctactttggcgacacggcacggctgccctacggcacgcgatcgccggcggagatt
cgccagttcgtgcgcgagatcttggactggatgcaggccgagggttgcaagttagtcgtt
atggcctgcaacaccagctcggccctagccctcgaagcgctgcgtggagactacaccatg
ccgctcattggcctcattcagcctgctgcgcgggttgccgtccaacggggccagcggatt
ggcgtgattgccacggctgccactgcccaaagtcgtgcctatcgccaggctctacgcgag
gccaaccccaacgttcaagtctgggaaattggctgccctgagttcgtccctttggtagag
cagcaacggattcatgatccccagacgctgcaggtggcagctcaataccttgctccattg
atcgaggcgcaggtggatacgttgatctatggttgtacccactacccgcatttagcgccg
gtgattcaacagctgctgcccagcagcacgcacctactggatccggcagaagccgtgacc
cgatcggtgcaaatggagctggaagtcttaggactcagtcacacctctaaggccagtacg
gtgcgattttgtgtcagccacgatcctcagcatttcagtctggcgatcgagcggtggcta
gggtttcaagctcctgtcgacctgattcaactaccgacgcgatcgcttccttctgcccac
tttgcttcggaagcggaaggcgtagcttag

DBGET integrated database retrieval system