KEGG   Synechococcus elongatus PCC6301: syc1743_c
Entry
syc1743_c         CDS       T00163                                 

Gene name
amiA
Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:syc00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    syc1743_c (amiA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syc01011]
    syc1743_c (amiA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:syc03036]
    syc1743_c (amiA)
Enzymes [BR:syc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     syc1743_c (amiA)
Peptidoglycan biosynthesis and degradation proteins [BR:syc01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   syc1743_c (amiA)
Chromosome and associated proteins [BR:syc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    syc1743_c (amiA)
SSDB
Motif
Pfam: Amidase_3 AMIN
Other DBs
NCBI-ProteinID: BAD79933
CyanoBase: syc1743_c
CYORF: syc1743_c
UniProt: A0A0H3K4E0
Position
complement(1889170..1890204)
AA seq 344 aa
MRSRTWAIGLGSLLLTTVLALPARANQLLFWRLDASQNRLEFKTQGAIAPQAQLIFNPQR
IVIDLPGATLPANRSPIQGGAGIREIRVGQPEAGITRLVIEIAPGYTVDPSQLRVEGPDA
TTWQIRLQPALRFAGGGIVPPRSPVTPPPSRQPQLPPPRSPQVGRQIVVIDPGHGGPDPG
AIGINGLQEAELVLDISQQVAAILRNSGLDVRMTRTADIDLDLEPRVQIAEQARADIFVS
IHANALSLDRPEVNGLETYYYASQAGERLARTIHQSILSSVSIRDRGVRQARFYVIRRTT
MPAVLVETGFVTGSEDSRNLANPNHRRKMAEAIARGILQYVRQN
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgcgatcgcgaacttgggctattggtctaggcagcctgttactcacgacagttttagcg
ttgccggcccgagccaatcaactgctgttttggcgcttggatgcgagtcagaatcgccta
gagttcaagactcaaggggcgatcgctccccaagcgcaactgatctttaatccccagcgg
atcgtgatcgacctgccgggcgccaccttacctgccaatcgatcgccgattcaggggggt
gccggtatccgggaaattcgggtgggtcagcccgaagccggcattactcgcctcgtgatt
gaaattgccccaggctatacagtcgatcccagtcagctacgggtcgaaggccccgatgcc
accacttggcagattcggctgcagccagcactccgctttgcaggtgggggcattgtgcca
ccgcgatcgccggtgacgcccccgccctctcgacagccccagctacccccaccgcgatcg
cctcaggtgggccgccagattgtcgtaattgacccaggtcatggcggtcccgatccaggt
gcgatcgggatcaacggcctgcaagaagcggagctggttctcgacatttcccagcaagtc
gccgcgattctccgcaacagcggtctcgatgtccgcatgactcgcaccgcggacatcgac
cttgatctcgagccacgggtacaaattgcagagcaggcccgtgccgatatttttgtcagc
atccatgccaatgccctcagtctcgatcgccccgaagtcaatggactcgagacctactac
tacgcttcccaagcgggagaacgactggctcgcactatccatcagtcaattctgtccagc
gtatcgattcgcgatcgcggtgtgcgtcaggcacggttttacgtgattcggcgtaccacc
atgcctgccgttctggtggaaaccggcttcgtgacgggcagtgaggacagccgcaaccta
gccaaccccaatcaccggcgcaaaatggcagaagcgatcgcccgcggtatcctacagtac
gtccgtcaaaactga

DBGET integrated database retrieval system