KEGG   Synechococcus elongatus PCC6301: syc1744_c
Entry
syc1744_c         CDS       T00163                                 

Definition
(GenBank) Na+/H+ antiporter
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-ProteinID: BAD79934
CyanoBase: syc1744_c
CYORF: syc1744_c
UniProt: A0A0H3KAQ0
Position
complement(1890254..1891636)
AA seq 460 aa
MLQFLSSALGWPPILAETIEIIESPEASTLILVSVLLGLVVVYLASKLGGELCVRVNLPP
VLGELLGGVLVGTSVLRLLVFPSSGAGAEDVVLLNFLQQISGAPDNWMPTIFATQSEVIS
VLSEIGVIILLFEIGLESNLDELLKVGTKAAIVAVVGVAAPFAAGTLGLIYLFHIATIPA
VFAGAALTATSIGITAKVLSELGRLNSPEGQIIIGAAIIDDILGIIVLAVVSSLAKTGEI
RPSNIVILIVSSTAFLVGAIFIGRWLNPFFVNLVSSMQTRGEVLVVALVAAILAGLIAQF
VRLEAILGAFAVGLILAETEKGEELKEQVKPLADVLVPIFFVVVGAKTDLSVLNPADPVN
RAGLIIAGFLLVVAVLGKVITGFRLVGSSTPLNRLAIGVGMIPRGEVGLVFAGVGASSGI
LSESLNAGVIVMVIMTTFLAPPLLRLAFRGEPTTAVEPGS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgcttcaattcttgagttcagcgctgggatggcctcccatcttggccgagacgattgag
attattgagagtcctgaagcctcgaccctgattttggtctctgtgcttctaggactggtc
gtggtctacctcgccagcaaactgggtggggaactctgcgtgcgtgtcaatctccccccc
gtgctgggtgagctactgggaggcgtcctggtcggcacctctgttctgcgacttctcgtg
ttcccctcgagtggagccggagccgaggatgtcgttctcctcaacttcctgcagcagatc
agcggcgcccctgacaactggatgccgacgatttttgcgacgcagtcagaagtgatctcg
gtgctgtctgagattggcgtcattatcctcttattcgaaattggcctcgaatctaacctc
gatgaactgctcaaggttggcacgaaggcagcgatcgtggccgttgtgggcgtcgcagca
ccctttgccgccggcacgttgggcctgatttacctgttccacattgcgacgattccggct
gtctttgccggggctgccctcaccgccactagcattggcattacagccaaggtgctgtct
gagctaggccgactcaattcaccagaaggtcaaatcatcattggcgccgccatcatcgat
gacatcctcggcatcatcgtcttggcggtcgtgagcagcttggcgaaaaccggcgaaatt
cgccccagcaacattgtgattttgatcgtcagctcgacggcctttttggtgggtgccatt
tttatcggccgctggctgaatccgttcttcgtcaacctggtcagcagcatgcagactcgg
ggtgaagtgctggtggtcgccttggtcgctgccatcctagcgggcttgattgctcagttt
gtgcgtctggaagccattttgggggcgtttgctgtcggcttaattttggctgaaaccgag
aagggcgaagaactgaaggagcaggtgaaacccctggctgacgttctcgtgccgatcttt
tttgtggtggttggtgccaaaaccgatctgagcgttctcaacccagccgatccagtcaat
cgggccgggctgattattgccggcttcttgctagttgtagccgtgctgggcaaagtgatc
accggcttccgcttggtgggtagttcgaccccgctcaaccgtctggcgataggcgtaggg
atgattccgcgcggtgaggtcggcctcgtttttgcaggggtgggcgcgagcagcggtatt
ctgtccgaatcgctgaacgcaggcgtgattgtcatggtgatcatgaccacgttcctggct
cccccgctgttgcggttagccttccgaggagaacccacgactgctgtggaacctggctct
tag

DBGET integrated database retrieval system