KEGG   Synechococcus elongatus PCC6301: syc1745_cHelp
Entry
syc1745_c         CDS       T00163                                 

Definition
(GenBank) nitrilase homolog
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    syc1745_c
Enzymes [BR:syc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     syc1745_c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: BAD79935
CyanoBase: syc1745_c
CYORF: syc1745_c
UniProt: A0A0H3K3N5
Position
complement(1891675..1892505)
Genome map
AA seq 276 aa AA seqDB search
MKSYLAAAVQMTSLPDLEKNLTQAEEWIDLAVRRGAELVGLPENFSFLGEEAQKVQQAPE
IAERTEKFLKTMAQRYQITLLGGGFPVPAEHNHVTNTLLLVGPDGQTLAQYNKVHLFDVD
LPDGNTYQESATVLAGREYPPVYDSERFGRLGFSICYDVRFPELYRHLANQSAEVIFVPA
AFTAFTGKDHWQVLLQARAIENTAYIIAPAQTGVHYGRRQTHGHAMIVDPWGIVLANAGR
EPGLAIAEISPRRLATVRQQMPCLQHRVLSTTVPSA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttacttggccgcagctgtgcagatgaccagtctgccggatctcgaaaagaat
ctcactcaagcggaagaatggatcgacctagccgtgcggcggggtgctgagcttgttggt
ctgcctgagaacttttcatttttaggggaagaggcccaaaaggttcagcaagcccctgag
attgctgaacgcaccgaaaagttcctgaaaacgatggcccagcgctatcaaattacgttg
ttgggcgggggcttcccggttccagccgagcacaatcacgtcaccaacacactacttctc
gttgggcctgatggtcagaccctagcccagtacaacaaggttcacctgttcgatgtcgac
ctcccggatggcaacacctatcaggagtcggcaacggttctcgctggtcgtgagtatccg
cccgtctatgactcggaacgttttgggcgcttgggattttcgatttgctatgacgtccgc
ttcccggaactttatcgccatctagccaatcagtcggcagaagtgatttttgtgccagcg
gcattcactgcctttaccggcaaagatcactggcaggtactgctgcaggcccgagcgatt
gagaatacggcatatatcattgcgccggcacaaacgggtgttcattacggacgccgtcaa
acccatggccacgccatgattgtcgatccgtgggggattgttttggccaatgcagggcgc
gagcctggcctcgcgatcgctgaaatctcgcctcggcggctggctaccgtgcgccagcag
atgccctgtctccaacaccgcgtcctttcaactacagtcccgagtgcataa

DBGET integrated database retrieval system