KEGG   Synechococcus elongatus PCC6301: syc1746_d
Entry
syc1746_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: GHL10 DUF4015
Other DBs
NCBI-ProteinID: BAD79936
CyanoBase: syc1746_d
CYORF: syc1746_d
UniProt: A0A0H3K402
Position
1892581..1894026
AA seq 481 aa
MPKSGPMPASLRRWLSGIAAIACLPLQSPAVNAQIAPAPSTGYNCDLALYSVPQANLLAR
SLQGDTVADQQYRQLVRELAMELRNCRQQVWPRKMAIWVRLYSCDLRPGGLDSLFDGLQA
LGYNEVFIETFYDGRVLLPAADNPTVWPSVVAEPGLERVDLLAEAIRKGRERGMSVYAWL
FTLNYGYSYSQRSDRQDTLARNGRSESSLEIVSGGAQVFVDPFNPVARQDYQTLLRSVLS
RRPDGVLFDYVRYPRGTGAASVMTKVADLLIHTTAARQAWINQLNTPAGQALLTEYLDTG
RLSPSDRNQLVLLLGDRLKELNLRQDVNPLWSLAVYHAWRGVVEFVDEAVGTVAQAGLPS
GAVFFPFGNARVGQQGWDSRMQPWDRFPNSMEYHPMSYALCGDRHDCVMAEVQRVLEAKP
NSIVQPAIAGTWGANFNAHLPLEQRMAALRSTFGDRIDRVSHFSLAWMDPQGERQRQRCR
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgcctaagagtggacccatgcctgcttcgcttcgacggtggttgagtggcatcgcagcg
atcgcctgtctgcctctgcagagccctgccgtcaatgcccagattgcaccggcacctagc
acaggctacaactgcgatttggcgctctactccgtgccccaagcgaacctactagcgcga
tcgctccaaggcgacacggtggccgaccagcagtatcgacaactcgtgcgcgagctagcg
atggaactgcgcaactgtcggcaacaggtctggccccgcaaaatggcgatctgggtcaga
ctatacagctgcgacctgcggccgggcggcttagactccctgttcgatggcctgcaagca
ttgggttacaacgaagttttcatcgaaactttctatgatggccgggtgctgctgcccgct
gccgacaaccccacagtttggccgtctgtggtggcagaaccgggattagaacgtgtcgat
cttctagcagaagccatccgcaaagggcgggagcggggcatgtcagtctatgcctggctg
ttcaccctcaactacggttacagctacagccagcgcagcgatcgccaagacaccctagct
cgcaatggccgcagcgagagcagtctcgaaattgtgtcaggaggtgcgcaggtctttgtc
gacccctttaatcccgtcgcccggcaagactaccaaaccttactgcgatccgttctgagc
cgtcgcccggatggggtgctgttcgactacgttcgctaccctcgaggcacaggggctgca
tcggtgatgacaaaagtggctgatctcctgattcatacgactgctgcccgtcaggcttgg
atcaatcagctcaacacgccggcaggtcaggcgttgctcacggaatatctcgatacggga
cgcctcagtccaagcgatcgcaaccaactggtgctgttgttgggcgatcgcctcaaggaa
ctcaacctacgacaggacgtaaatccactctggtcattggccgtctatcatgcctggcgc
ggtgtggtggaatttgtcgatgaggctgtgggcacggttgcgcaggcaggtctgccttcc
ggggccgtcttcttcccctttggcaatgcgcgggtagggcagcagggttgggactcccgc
atgcagccttgggaccgattccccaacagcatggaatatcacccgatgagttatgccctc
tgcggcgatcgccacgactgcgtgatggcagaagtgcagcgggttttggaggcgaaacct
aactcaatcgttcaacccgcgatcgcaggcacttggggcgccaactttaatgcccatcta
cccctcgaacagcgcatggccgcgctccggtcaaccttcggcgatcgcatcgatcgcgtt
agtcatttctctttagcttggatggatccccaaggggaacgtcagcgccaacgctgtcgt
ctctaa

DBGET integrated database retrieval system