KEGG   Synechococcus elongatus PCC6301: syc1747_d
Entry
syc1747_d         CDS       T00163                                 

Gene name
cysR
Definition
(GenBank) transcriptional regulator CRP family protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: HTH_Crp_2 Crp cNMP_binding HTH_24 HTH_IclR MarR HTH_28 HTH_29
Other DBs
NCBI-ProteinID: BAD79937
CyanoBase: syc1747_d
CYORF: syc1747_d
UniProt: A0A0H3K766
Position
1894193..1894834
AA seq 213 aa
MRENIMTPVWTRPTLASGQLRQVLEQIYRDRPMLHFTAGQTVPLPQDSIWVVCRGIALIT
TSYESGDEALLGLAGPSMPFGSALSWVMPYEVQALTDLDLIRLKLVEIEQTPLLAQDLFL
MLAQRHRQTEMLLSPIGQRRVEDRLRNFLQLLGREFGQPEDQLLRLNCRLTHQHLANALG
TTRVTVTRLIGQFRREGWLDFDDQRHLVLKGLL
NT seq 642 nt   +upstreamnt  +downstreamnt
atgcgggaaaacatcatgactccagtctggacacgccccacccttgcctctggtcagctg
cgtcaggttctggaacaaatctaccgcgatcggccgatgctgcatttcaccgcaggtcaa
actgttccgctgccccaagattcaatttgggtcgtttgtcgcggtattgccttgatcacc
acaagctatgaaagtggcgatgaggcgttgttaggactggcgggtccttcgatgcctttt
ggctctgccctctcttgggtgatgccctacgaagttcaggcactgacggatctggacttg
attcgtctcaaactggttgaaattgagcaaacgcctctgcttgcacaagatctcttcttg
atgttggcgcagcgccatcgccagaccgaaatgctgctgagtccgattggtcaacgccgc
gttgaagaccgtttgcgcaacttcttgcaactgctgggccgcgaatttggtcagcccgaa
gatcaactactgcgcctcaactgtcggctgacccatcaacacttggccaacgccctgggc
acaactcgcgtcaccgtgactcgtctgattggccaattccggcgggagggctggttagat
tttgatgaccaacgccaccttgtcttgaagggcctgctctag

DBGET integrated database retrieval system