KEGG   Synechococcus elongatus PCC6301: syc1748_d
Entry
syc1748_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Phasin PHA_synth_III_E TolA_bind_tri Serine_rich HalX Apolipoprotein Mitofilin BssS ABC_tran_CTD Arg_decarbox_C BMFP DUF4140 HSBP1 Spore_III_AB Rad50_zn_hook TSC22 SlyX FUSC
Other DBs
NCBI-ProteinID: BAD79938
CyanoBase: syc1748_d
CYORF: syc1748_d
UniProt: A0A0H3K4E5
Position
1894925..1895248
AA seq 107 aa
MDRNNLLQHLLIFGIGTTARVADRLRGVSDEWVRTGRLDPDQAKALIDELQQQLKSEGEE
LDQRWQRQWRDWINELGLARQSEVDELRGRIDRLERQLRALEDRGWR
NT seq 324 nt   +upstreamnt  +downstreamnt
atggaccgaaataacttgctgcaacatctgctaatcttcggcattggcacgacagctcgt
gtggccgatcgcttgcggggggtcagtgacgagtgggtgcgcaccggacgactggatccg
gatcaggccaaagcgctgattgatgaactgcagcagcaactcaagtctgagggcgaagaa
ctcgaccagcgctggcaacgacagtggcgcgattggattaacgagctggggctagctcgt
caatctgaagtggatgaattgcgaggccggattgatcgcctcgaacgtcagttgcgagct
ttagaggatcgcggatggcgctaa

DBGET integrated database retrieval system