KEGG   Synechococcus elongatus PCC6301: syc1749_d
Entry
syc1749_d         CDS       T00163                                 

Definition
(GenBank) FKBP-type peptidyl-prolyl cis-trans isomerase
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    syc1749_d
Enzymes [BR:syc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     syc1749_d
SSDB
Motif
Pfam: FKBP_C ExbD
Other DBs
NCBI-ProteinID: BAD79939
CyanoBase: syc1749_d
CYORF: syc1749_d
UniProt: A0A0H3KAQ8
Position
1895301..1895825
AA seq 174 aa
MRDILISFAAMLLCLIVFVAAQVFGPTTPAAIAAPSAVEASPPVAAVPPTPIISQTTQSE
TIVTTASGLQYVDLEVGTGATPQPGQTVVVHYTGTLEDGTQFDSSRDRNRPFQFKLGVGQ
VIKGWDEGIATMKVGGRRKLTIPPTLAYGERGAGGVIPPNATLIFDVELIRIAG
NT seq 525 nt   +upstreamnt  +downstreamnt
gtgcgtgacattctgatcagttttgcagccatgctgctctgcctgatcgtctttgtcgcg
gctcaggtgtttggaccgacaacacccgctgcgatcgctgcacccagtgctgtcgaggca
tctcctccggttgcggctgttccgccaaccccgatcatttcccagaccactcaatcggaa
actattgtgacgacagcttctggcctgcagtatgtggatttggaagtcggcaccggagct
acgccccaaccgggtcaaaccgtggtggttcactacacaggcaccctcgaggatggcacc
cagttcgacagctctcgcgatcgcaaccggcctttccagttcaagctaggtgttggccaa
gtgatcaaaggctgggatgaaggcattgccaccatgaaagtgggcggtcgccgcaagctg
acgattccgccgactttggcctacggtgagcgcggtgctggtggcgtcattccccccaat
gccacgctgatctttgatgttgaactgattcgcattgcaggctag

DBGET integrated database retrieval system