KEGG   Synechococcus elongatus PCC6301: syc1750_c
Entry
syc1750_c         CDS       T00163                                 

Gene name
lipB
Definition
(GenBank) lipoate-protein ligase B
  KO
K03801  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00785  Lipoic acid metabolism
syc01100  Metabolic pathways
syc01240  Biosynthesis of cofactors
Module
syc_M00881  Lipoic acid biosynthesis, plants and bacteria, octanoyl-ACP => dihydrolipoyl-E2/H
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    syc1750_c (lipB)
Enzymes [BR:syc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     syc1750_c (lipB)
SSDB
Motif
Pfam: BPL_LplA_LipB
Other DBs
NCBI-ProteinID: BAD79940
CyanoBase: syc1750_c
CYORF: syc1750_c
UniProt: Q5N180
Position
complement(1895922..1896623)
AA seq 233 aa
MSARAAWLVQAGCLDYAQVWAWQRQLQDNRRNNPDRPDVLLLLEHPAVYTLGRGSSLAHL
KFDPQHPPAPVYRIERGGEVTHHAPGQLVGYPILNLRHHRCDLHWYLRQLEAVLILVLAN
YGLTGERIEGLTGVWVEGKKLAAIGIQVSRWISLHGFALNVCPDLAGFEAIVPCGISDRA
VGSLVEFCPDVRLEVVRSQVAGAFAQTFELDLQPCSLEQLQAEENLTAIAGDP
NT seq 702 nt   +upstreamnt  +downstreamnt
gtgtccgctcgtgctgcttggctggtgcaagccggctgtttagactacgcccaagtttgg
gcttggcaacgccaacttcaggacaatcgccgcaataaccccgatcgccccgatgtgttg
ctactgctcgagcatccggctgtttacaccttggggcggggttcgagcttagcccatctc
aagtttgatccgcagcatcccccagcgccggtctatcgcattgaacgcgggggtgaagtc
acccaccatgcgccagggcagctggttggatatccaatcctgaacttgcgccaccatcgc
tgcgatctgcattggtatctacgccagctcgaagcagtcctgatcttggttctggccaac
tatggcctgactggcgaacggattgaaggactgactggcgtgtgggttgaggggaaaaag
ctagccgcgatcgggattcaagtcagtcgttggatcagcctgcatggctttgccctcaat
gtctgccctgatctagctggctttgaagcgatcgtgccctgtggcatcagtgatcgcgct
gtcggcagtctggttgagttttgtccagacgtgcgcctagaggtcgtgcgatcgcaggta
gcaggcgcttttgcccagacctttgaactagatcttcagccctgctccttagaacaactc
caagctgaagaaaatctgactgcgatcgcaggtgatccctaa

DBGET integrated database retrieval system