KEGG   Synechococcus elongatus PCC6301: syc1751_d
Entry
syc1751_d         CDS       T00163                                 

Gene name
lrtA
Definition
(GenBank) light repressed protein A homolog
  KO
K05808  putative sigma-54 modulation protein
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:syc03009]
    syc1751_d (lrtA)
Ribosome biogenesis [BR:syc03009]
 Prokaryotic type
  Other maturation factors
   syc1751_d (lrtA)
SSDB
Motif
Pfam: Ribosomal_S30AE Ribosom_S30AE_C Med29 TAP42 DUF2097 DUF4143
Other DBs
NCBI-ProteinID: BAD79941
CyanoBase: syc1751_d
CYORF: syc1751_d
UniProt: A0A0H3K3N9
Position
1896829..1897452
AA seq 207 aa
MKLVVQGTNIDVTAAIHDYVQQKLDKAVSHYQSFLTEIDVHLSVAKHAKSNPRQTAEVTI
YANGTVIRAEECNENLYASIDLVSDKITRQLKKYKEELRDRKGQLSTAETADQLSDGALV
TDLLNGRQPELPQDIVRTKYFAMPAMTVEDALAQLQLVDHDFYMFRNAATGEINVIYERN
HGGYGVIQPRPEGNSEKAVVVRSEAVL
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaagctagtcgtccagggaaccaacatcgatgtcactgctgcaattcatgattatgtg
cagcaaaagctggacaaagctgttagccactaccagagcttcttgactgagattgatgtt
catttatctgttgctaaacatgctaaatcgaatccgcgtcaaacggctgaggtcaccatt
tatgcgaatggcacggtcattcgagcggaagagtgcaatgaaaatctttacgccagtatc
gatttagtttcagataaaattactcgccaactgaagaaatataaggaggaactccgcgat
cgcaaaggtcagctctcaactgcagaaactgctgatcagctctcggatggtgccctcgtc
accgatttgctcaacggccggcagcccgaacttcctcaggacattgtgcgaacgaaatac
ttcgctatgccagccatgaccgtcgaagatgccttggcacagctacaactagttgatcac
gacttctatatgttccgcaatgcggcgacgggagaaatcaacgtgatctatgagcgtaat
cacggcggttacggtgtgattcaacctcgacccgaaggcaactcagagaaggcggtagtc
gtgcgaagtgaggcagtgctctag

DBGET integrated database retrieval system