KEGG   Synechococcus elongatus PCC6301: syc1752_c
Entry
syc1752_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K09121  pyridinium-3,5-bisthiocarboxylic acid mononucleotide nickel chelatase [EC:4.99.1.12]
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    syc1752_c
Enzymes [BR:syc01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.12  pyridinium-3,5-bisthiocarboxylic acid mononucleotide nickel chelatase
     syc1752_c
SSDB
Motif
Pfam: DUF111
Other DBs
NCBI-ProteinID: BAD79942
CyanoBase: syc1752_c
CYORF: syc1752_c
UniProt: A0A0H3K407
Position
complement(1897509..1898756)
AA seq 415 aa
MNAVVLRHGPFPRMTQIAYFDCPTGIAGNMCLGALVDAGVPLSYLEQQLQRLSLSEPYQL
VATPVLRQGMAATYVEVQIEAAPHAHRHLSHIVALIEAAGLPDRVRDWSIAVFQQLAIAE
AAVHGVTPEQVHFHEVGATDAIVDIVGTCLGLDYLGIEAVYCSALPTGGGTVKAAHGQLS
VPVPAVLRLWQLRQVPVYSNGIERELVTPTGAAIAVTLAKSFGPPPSLQLQKTGWGAGSH
DLPIPNLLKLWIGTASDLVMTPQSPEGSLETVQVIETQIDDCSPQVLAYVSEQLLAQGAL
EVFSQAITMKKGRLGTLLTIICQPDQQAACETILFRETTTIGLRFRREQRRVLPRRRDRV
QTPWGEVRVKVAGDPQSPLTVQPEYEDCRAIAQAQQIALHHIQTVAQQQWQQENA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaatgcggtagtgcttcgccatggtcccttccctcgtatgactcaaatcgcttacttt
gactgcccaactggcattgctggcaacatgtgtttgggtgcccttgtggatgcaggcgtt
cccctcagctacctcgagcagcagttgcagcgactgtcgttgagcgaaccctaccagctt
gtggcaacgccagtgctacggcaggggatggccgcaacctacgtcgaggttcagatcgag
gcagctccacatgcccatcgccatctttctcatattgtcgctctgattgaagctgctggt
ttgcccgatcgcgtccgcgactggagtattgcggtttttcaacagttggcgatcgcagaa
gcagcagttcatggcgtcacgcctgagcaagtgcacttccacgaagtgggtgccaccgac
gccattgttgatattgtcgggacctgcttggggttggattacctgggcattgaagccgtc
tattgttcggcactgcccacggggggtggcaccgtcaaagcagcccacggacagctttct
gtgcctgttccggccgtgctgaggctctggcagctacgccaggtgccggtttatagcaat
ggcattgagcgcgagttagtcacgccgacaggggccgcgatcgcggtcaccttggcaaaa
tcctttgggccacccccctctctccagctccaaaagacaggctggggggcgggtagccac
gatctgccgatccctaacttgctcaagctttggattgggaccgctagcgatctggtcatg
acgccccaaagtccagaaggcagtctagaaacggttcaagtgatcgaaacccaaattgat
gattgcagcccacaggtgttggcttacgtcagtgagcagttgctcgctcagggagcactg
gaggtttttagccaggcgatcacaatgaagaagggacggcttgggacgctgctgacgatc
atttgtcagcccgatcagcaggcagcctgcgaaaccatcctcttccgagagaccaccacc
attggcctgcggttccgtagagaacagcgtcgggtcttgccgcgtcgccgcgatcgcgtg
caaacaccgtggggagaggtgcgggtgaaggtcgctggtgatccgcaatcgcccctcacc
gttcagcctgagtatgaagattgtcgagcgatcgcccaagcacaacagatcgcactgcac
cacattcagacggttgctcagcaacaatggcaacaagaaaacgcctga

DBGET integrated database retrieval system