KEGG   Synechococcus elongatus PCC6301: syc1753_d
Entry
syc1753_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Sua5_yciO_yrdC
Other DBs
NCBI-ProteinID: BAD79943
CyanoBase: syc1753_d
CYORF: syc1753_d
UniProt: A0A0H3K772
Position
1898733..1899434
AA seq 233 aa
MAKHYRIHPDSPQPQQIAAIAEALRQGAVILYPTDSVYAIGCDVKDRAAVQRVRRIKEID
NDKPLTFICPSLSVAAQYGCISDRAFRLMRELVPGPYTFLLPATPEVPRVVMNPKRRTAG
IRIPNNPICQALLQALEGPIISTSAHLQPSDRKAPLAYEQGPHCPIAPAELFGEVDRLVD
ITIEVERQEMRILGADPDYQVSTVLDLTDDWPLVLRRGLGWEALEPLGLLVEA
NT seq 702 nt   +upstreamnt  +downstreamnt
atggcgaagcactaccgcattcatccagacagcccacaacctcagcagatcgccgcaatc
gctgaagccctgcgtcagggggctgtcattctgtatccaaccgattcagtctacgcgatt
ggttgtgatgtcaaagaccgtgcagcggtgcaacgggtgcgccggatcaaggaaattgac
aatgacaagccgctgacctttatctgtccgtctctctccgtagccgcccaatacggctgc
attagcgatcgcgcttttcgcttgatgcgcgaactggtgccagggccctacacctttttg
ctgcccgcgacgcccgaggtgccgcgcgtggtcatgaatcccaaacggcggaccgccggt
attcgcattcccaacaaccccatctgccaagccctcttgcaggcgctggaaggcccaatc
atctcgacctcggcacatctacagcccagcgatcgcaaagctcccttagcttacgaacaa
ggcccccattgcccgatcgcccccgctgaactgtttggggaggtcgatcgcctcgtcgac
atcaccatcgaggtcgaacgccaggagatgcggattctcggtgccgatcctgattaccaa
gtgtcaactgttctcgacttgaccgatgactggcccttggtcctgcgccgaggcttgggc
tgggaagcccttgaaccgctgggtttgctggtcgaagcttag

DBGET integrated database retrieval system