KEGG   Synechococcus elongatus PCC6301: syc1754_c
Entry
syc1754_c         CDS       T00163                                 

Gene name
pilT2
Definition
(GenBank) twitching mobility protein
  KO
K02669  twitching motility protein PilT
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:syc02044]
    syc1754_c (pilT2)
   02035 Bacterial motility proteins [BR:syc02035]
    syc1754_c (pilT2)
Secretion system [BR:syc02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   syc1754_c (pilT2)
  Type IVa pilus homolog protein
   syc1754_c (pilT2)
Bacterial motility proteins [BR:syc02035]
 Pilus system
  Twitching motility proteins
   syc1754_c (pilT2)
SSDB
Motif
Pfam: T2SSE AAA_29 AAA_23 ABC_tran AAA_16 AAA_30 AAA_22 FtsK_SpoIIIE AAA_19 Zeta_toxin NTPase_1 DUF87 TK TrwB_AAD_bind AAA_27 ResIII AAA SRP54 AAA_7 AAA_11 AAA_33 Rad17 SWI2_SNF2 ATP_bind_1 cobW AAA_18 DEAD DAP3 AAA_14 AAA_5 PRK SMC_N
Other DBs
NCBI-ProteinID: BAD79944
CyanoBase: syc1754_c
CYORF: syc1754_c
UniProt: A0A0H3K4E9
Position
complement(1899447..1900640)
AA seq 397 aa
MTDTSRLPLPPPPPPFGAGGLSAMPVTQVSASPATPAAVPQRSANQPTLAEIVRQAYEHD
YSDVHLGVGEVPRFRDRGEIVQTTYPVTDTATFNAWLREVLTEAQVREFEQGLDFDGATQ
YDFARVRINIFGSLRGPSMVMRLIPLRILSLDELSLPPVFRDICYYPKGLVLVTGPTGSG
KSTTLAAMIDFINQEMAKNIITIEDPIEFVHQSQRSLIKQREVGVHTRQFEAALRASLRE
DPDIILVGELRDRETINTALKAAQTGHLVMATLHTNSAVKTIERVLNMFEPAEQPPVRVA
LAESLVSVIAQGLCRTIHGKRTAYHEILINTDAIKDYIIRGELEEVEQLIPKCTFDGMCT
SNQSLFRLFNEGKISEETALAQSGKPNEMSQMLRGRV
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgactgatacctcgcgcctgccactcccaccgcctccccctccctttggtgcaggtgga
ctgtctgcgatgcccgtcacccaggtcagcgcttccccggcaaccccagcagccgtgccc
caacgatcggccaatcagccaacccttgccgaaattgtgcggcaggcctacgagcacgat
tactcggatgtccaccttggcgtgggggaagtgccgcgttttcgcgatcgcggtgaaatt
gtgcaaacaacctatccagtcaccgacacagctacctttaacgcctggctgcgcgaggtt
ttgaccgaagcgcaagtgcgtgaatttgagcagggattggacttcgacggcgcaactcag
tacgactttgcgcgggtacggatcaacatctttgggtcgctgcgaggtccctcgatggtg
atgcggttaattccgctgcgcattctcagcctcgatgagctgagcctaccgccggttttc
cgcgacatctgctactaccccaaaggactggtactggtcaccggccccacagggtcaggc
aagtcgaccacgctggccgccatgattgatttcatcaatcaggaaatggcgaagaatatc
atcaccatcgaagacccgattgaatttgttcaccaaagtcagcgatcgctcattaagcag
cgggaagtcggcgttcatacccgtcaatttgaagcagcactacgggcctctttgcgtgag
gatcctgacattatcttggtgggtgagctgcgcgatcgcgaaacgatcaataccgctctc
aaagctgcacaaaccggccacctcgtgatggctactctgcacactaacagcgctgtcaaa
acaattgagcgggtactcaatatgtttgaacccgctgaacaaccgcctgttcgagttgcc
ttggccgagtcgctcgtgtctgtgattgcgcaaggtctctgccgcacgattcacggcaag
cggactgcctatcacgaaattttgattaacactgacgcgatcaaggactacattattcgc
ggcgaacttgaggaagttgagcaactaattcctaaatgtacctttgacggcatgtgcacc
agcaatcagtccctattccgtctctttaacgaaggcaaaattagtgaggagactgcactg
gcgcaatctggcaagcccaatgaaatgtctcagatgctgcgaggtcgggtttag

DBGET integrated database retrieval system