KEGG   Synechococcus elongatus PCC6301: syc1755_c
Entry
syc1755_c         CDS       T00163                                 

Gene name
queA
Definition
(GenBank) S-adenosylmethionine:tRNA ribosyltransferase-isomerase
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:syc03016]
    syc1755_c (queA)
Enzymes [BR:syc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     syc1755_c (queA)
Transfer RNA biogenesis [BR:syc03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    syc1755_c (queA)
SSDB
Motif
Pfam: Queuosine_synth
Other DBs
NCBI-ProteinID: BAD79945
CyanoBase: syc1755_c
CYORF: syc1755_c
UniProt: Q5N175
Position
complement(1900715..1901794)
AA seq 359 aa
MNEPSPSDWHLDAYDYELPPDRIAQSAVEPRDHARLSVFPDREQLWHRHFYDLPQLLRPG
DLLIVNDTRVIPARLYGQKIETGVPVEVLLVEEHGPGYWLTLVKPGKRLKPGSAIAFGPN
PEDPLLVADVEASDPATGGRWLRFRGEAEAFWSQLATLGEMPLPPYIHTTASDPERYQTV
YSRELGAVAAPTAGLHFTPELLTTLADMGIATAPVTLHVGIGTFRSVDVEDIRQHEMHSE
RMMVPAATVEKIQATKAAGGRVIAVGTTSVRAIEGAAASGELKPGSDRVNLFIYPGYRWQ
IIDGLITNFHLPRSSLMMLVSALIGRDRLLSAYATAIAEQYRFYSFGDAMLILPDAKLP
NT seq 1080 nt   +upstreamnt  +downstreamnt
gtgaacgagccttctccctccgattggcatctagatgcctacgactacgagctaccaccg
gaccggattgcccagagtgccgtggagcctcgggaccatgcccgcctatcggtctttccc
gatcgcgagcaactatggcatcggcatttttacgatctgccgcaacttctgcgcccggga
gacttgttgatcgtcaatgacacgcgggttatccctgctcgactctacggccaaaaaatc
gagaccggcgtgcccgttgaagtgctgctagtcgaggaacacggacccggctattggctc
accctcgtcaagccgggcaaacgtctcaaacccggatcagcgatcgcctttgggccgaat
cctgaggatcctctcctggttgctgacgtggaagcgagcgatccggccacgggcgggcgt
tggttacgttttcggggcgaagccgaagcattttggtctcagctggcaaccctcggggaa
atgccactaccgccctatatccacaccaccgccagcgatcctgaacgctatcaaacggtc
tacagtcgcgaactcggagcagtagccgcaccgactgcaggcctccactttacgcctgag
ttgctgacaaccttggcagacatggggatcgccacggctcccgtgaccctgcacgtcggt
attgggacctttcgctcagtcgatgtggaggacattcgtcagcacgagatgcatagcgag
cggatgatggttccagccgctacggttgagaaaattcaggcgaccaaagcggccggtggc
cgggtgatcgcagttggtaccaccagcgtgcgagcgattgaaggagccgctgcttcgggt
gaactcaaaccagggagcgatcgcgtcaacttgttcatttatccgggctatcgctggcag
atcatcgacggcttgatcacgaacttccacctgccacgttcgagcctgatgatgttggtt
agtgccttgatcgggcgtgatcgtctcttgtcagcctacgcaacggcgatcgctgaacag
tatcgcttctattcttttggcgatgccatgctgattctgcccgacgctaagctgccctga

DBGET integrated database retrieval system