KEGG   Synechococcus elongatus PCC6301: syc1756_d
Entry
syc1756_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Cupin_2 AraC_binding Med25_NR-box
Other DBs
NCBI-ProteinID: BAD79946
CyanoBase: syc1756_d
CYORF: syc1756_d
UniProt: A0A0H3KAR6
Position
1901765..1902889
AA seq 374 aa
MPIGGRRLVHRQQLEGVTLRQRIQAMSDCNRDPVSQITDLSGALVTIVPSLLACVGMVFA
SNLTDVTAEALLYDYREAANPLGQRLIARVPYQDWGAELHQTPETAIIPLDLSEALGCEG
PATSPSLLANFVHILPNQAIETTAIATSQIFYVLRGQGVTRVADQEIAWTEGCCLALPAD
AIATHYAQTDSAFYWVHDAPLLRYLGVKPDRARFQPTLYRRQDLEATLAAIAADPQSRKA
NRLSVLLANQNFPQTRTITHTIWAMFGLLPPDVVQAPHRHQSVALDLILDCQPGCYTLVG
TQLDERGQIRNPVRVDWRPYSVFVTPPGYWHAHYNESGQEAHLLPIQDAGLHTYLRTLDI
LFARHNGQISDEAA
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgccaatcggagggagaaggctcgttcacagacagcagctcgaaggggtgacgttaaga
cagcgaatccaagcaatgagcgattgcaatcgcgatcccgtgtctcagataacagatctg
agtggtgcgctcgttacaatcgtgccatcgctgctggcctgcgttggtatggtgtttgct
tctaacttgaccgatgtgaccgccgaggccctgctctacgactaccgtgaagcggccaat
cccctggggcagcgcctgattgcgcgggttccctatcaagactggggtgcagagctgcac
caaactccagagacggcaatcattccgctcgaccttagcgaagccttgggttgcgaaggg
ccagcaacctcgccctccctgctggcgaacttcgtccatatcttgccgaatcaggcgatt
gaaaccaccgcgatcgccaccagccagatcttttatgtgttgcgcggacaaggcgtgacc
cgcgttgccgatcaggaaattgcttggacggaaggctgctgcttagcgttgcccgccgat
gcgatcgccacccactacgcccagacagacagtgccttttactgggtgcatgatgcgccg
ctcctgcgctacctcggtgtcaagcccgatcgcgcccgcttccaacccaccctctaccgc
cgtcaagatcttgaggcaactctggcggcgatcgcagccgatccccaatccagaaaggcg
aatcgcctcagtgtgttgctggccaaccaaaactttccccagacgcgaacgatcacccac
acaatttgggcaatgtttgggttgctgccacccgatgtggtgcaagccccccaccgccat
caatccgtggcgctggacttgattctggattgtcagcccggttgctacaccctggtggga
acccagctagatgagcgtgggcaaattcgcaatccggtgcgggtcgattggcgaccttac
tccgtgtttgtgactccgccgggctactggcatgcccactacaacgagtcagggcaggag
gctcatctgctgccgattcaagatgcgggcctgcacacctatctgcggacccttgacatt
ttgtttgcccgtcacaacggccagatctcggacgaggcggcttag

DBGET integrated database retrieval system