KEGG   Synechococcus elongatus PCC6301: syc1757_c
Entry
syc1757_c         CDS       T00163                                 

Gene name
hisB
Definition
(GenBank) imidazoleglycerol-phosphate dehydratase
  KO
K11777  HAD superfamily phosphatase
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    syc1757_c (hisB)
SSDB
Motif
Pfam: Hydrolase HAD_2 PAS_4
Other DBs
NCBI-ProteinID: BAD79947
CyanoBase: syc1757_c
CYORF: syc1757_c
UniProt: A0A0H3K3P5
Position
complement(1902886..1903686)
AA seq 266 aa
MESSTVTQPWAIAVFDIDGVVRDVSRSYRRALADTVEHFTDGGYRPTPADIDRLKGEGSW
NNDWKASEELIYRYYESQGRDRNTLALDYETIVAFFQVRYRGKQPDRPAAWDGYICDEPL
LMSADYLQSLSRAGIAWGFFSGATPASARFVLEQRLGITPTVLIAMGDAPDKPNPTGLIT
AAQQLATNPHLPAIYAGDTVADILTVRRARYEASDRPWYAVGVLPPHLETASDRDRYAQQ
LTEAGADCVIEGVEALTSDHIQALLA
NT seq 801 nt   +upstreamnt  +downstreamnt
atggagagcagtactgtgacacagccttgggcgatcgcggtgtttgatattgacggcgtc
gtgcgcgatgtcagccgttcctatcggcgggcgttggccgacacggtcgagcatttcacg
gatggagggtaccgccctactccagcggatatcgatcgcctcaagggcgaaggcagttgg
aacaacgactggaaagcctccgaggaattgatctatcgctactacgaaagtcagggacgc
gatcgcaacaccctcgccttggactacgagacgatcgtcgccttttttcaagtgcgctac
cgaggcaagcagccagataggccagccgcatgggatggctacatctgcgatgaacccttg
ctgatgtctgctgattatctgcagtccttgagtcgcgctggaattgcttggggctttttc
agtggagcaacccccgcttccgcccgctttgtactggaacaacgcctgggcattacaccc
accgtgctgattgccatgggcgatgcaccggataaacccaacccgaccggcttgatcaca
gccgcccagcagctcgcaaccaatccccacctgcctgccatctacgccggcgacacggtc
gctgatattttgacggtgcggcgtgcccgctacgaagcaagcgatcgcccttggtatgcc
gtcggtgttttgcccccgcatctagagactgccagcgatcgcgatcgctatgcccaacag
ctgacagaagcgggcgcagactgcgttatcgagggtgtggaagccctgaccagcgatcac
attcaagcactgctagcctaa

DBGET integrated database retrieval system