KEGG   Synechococcus elongatus PCC6301: syc1760_d
Entry
syc1760_d         CDS       T00163                                 

Gene name
psaI
Definition
(GenBank) photosystem I reaction center subunit VIII
  KO
K02696  photosystem I subunit VIII
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1760_d (psaI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1760_d (psaI)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Other common subunits
    syc1760_d (psaI)
SSDB
Motif
Pfam: PSI_8
Other DBs
NCBI-ProteinID: BAD79950
CyanoBase: syc1760_d
CYORF: syc1760_d
UniProt: A0A0H3K775
Position
1905889..1906005
AA seq 38 aa
MSGDFAAAFLPTIFVPLVGLGLPAVLMSLLFTYIESEA
NT seq 117 nt   +upstreamnt  +downstreamnt
atgtctggtgactttgctgctgccttcttgccgaccatttttgtgccgctcgtgggtttg
ggtttacctgcagtcctcatgagcttgctcttcacttacattgagtcggaagcctag

DBGET integrated database retrieval system