KEGG   Synechococcus elongatus PCC6301: syc1761_d
Entry
syc1761_d         CDS       T00163                                 

Gene name
psaL
Definition
(GenBank) photosystem I reaction center subunit XI
  KO
K02699  photosystem I subunit XI
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1761_d (psaL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1761_d (psaL)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Other common subunits
    syc1761_d (psaL)
SSDB
Motif
Pfam: PsaL Internalin_N
Other DBs
NCBI-ProteinID: BAD79951
CyanoBase: syc1761_d
CYORF: syc1761_d
UniProt: P31084
Position
1906203..1906550
AA seq 115 aa
MAHGFLLYGPLSILGPLRNTETAGSAGLLATVGLVVILTVCLSLYGNAGSGPSAAESTVT
TPNPPQELFTKEGWSEFTSGFILGGLGGAFFAFYLASTPYVQPLVKIAAGVWSVH
NT seq 348 nt   +upstreamnt  +downstreamnt
atggctcatggcttcttgctctacgggccgctcagcattttgggccctctgcgcaatacc
gaaacggcaggttctgctggcctgttggcaactgttggcttggtggtgattttgacggtg
tgcctgtcgctctacggcaatgccggatcgggcccttcagcggctgaaagcaccgtgacc
actccgaatccgccccaagaactgttcaccaaagagggctggagcgagttcaccagcggt
ttcatcctcggtggcttgggcggcgctttcttcgccttctacctggcttcgaccccctac
gtgcaacctctggtcaaaatcgccgctggcgtttggtcggtgcactaa

DBGET integrated database retrieval system