KEGG   Synechococcus elongatus PCC6301: syc1763_c
Entry
syc1763_c         CDS       T00163                                 

Definition
(GenBank) GTP-binding protein engA
  KO
K03977  GTPase
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:syc03009]
    syc1763_c
Ribosome biogenesis [BR:syc03009]
 Prokaryotic type
  GTPases
   syc1763_c
SSDB
Motif
Pfam: MMR_HSR1 KH_dom-like GTP_EFTU FeoB_N Dynamin_N AIG1 RsgA_GTPase Roc Ras MeaB ABC_tran AAA_16 TniB cobW AAA_18 AAA_28
Other DBs
NCBI-ProteinID: BAD79953
CyanoBase: syc1763_c
CYORF: syc1763_c
UniProt: Q5N167
Position
complement(1907785..1909146)
AA seq 453 aa
MPLPIVAILGRPNVGKSTLVNRLAGSREAIVHDEPGVTRDRTYQEAFWCDRDFTVVDTGG
LVFDDDTEFLPLIREQAELALAEAALAVLVVDGQAGLTAADNEIADWLRHQNRPIVVAVN
KCESPDKGAAQAAEFWSLGFGEPLPISSIHGSGTGELLDRVLELLPPADEAAGDETEIGV
AIVGRPNVGKSSLLNSFLGEQRAIVSPIAGTTRDAIDTVIERNDQRYRLVDTAGIRRKRG
VDYGPEFFGINRSFKAIRRADVCLLVIDVLDGVTDQDQKLAGRIEEDGRACVIVVNKWDA
HEKDSSTIYEVERQLRDRLYFLDWAPMIFVSALTGQRVEKILDQVNTVVEQHRRRVGTSV
INEVLGDAIAWRTPPTTRQGRQGRIYYGTQVTTQPPSFTLFVNDPKLFGESYRRYIERQF
RESLGFSGTPIRLFWRGKKSRELERGANRATRV
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgccgctgccgattgtcgccattcttggccgaccgaatgttgggaaatctacgttagtc
aatcgtttggccggcagccgcgaagcgatcgtccacgatgaacctggtgtcacccgcgat
cgcacataccaagaagcgttttggtgcgatcgcgattttacggtggttgataccggcggt
cttgtctttgatgatgacaccgaatttttgcccctgatccgcgaacaagctgagttagca
ctagcagaagcggctctcgccgttttagtcgtcgatggccaggccggtttaacagcggcg
gataacgaaattgctgactggctgcgccatcaaaatcgcccgatcgtggtggcagtgaac
aaatgcgaatcgccggataaaggcgcggcccaagcggcggaattttggagcttaggcttt
ggtgagccgctaccaatttccagcatccacggcagcggcacgggcgaactgctcgatcgc
gttttggaactattgcccccggcggatgaagcagctggggacgaaaccgaaatcggagtc
gcgatcgtcggtcgtcccaatgtcggtaaatccagtctgctcaactcctttttgggcgaa
cagcgggcgatcgtcagcccgatcgcgggcaccactcgcgatgcgatcgacacggtgatt
gagcgcaatgatcagcgctatcgcctcgttgacacggcagggattcgccgcaaacgtggg
gtcgattatggccccgaattctttggcatcaaccgctcctttaaagcgattcgtcgcgcc
gatgtctgcctgctggtgatcgatgtgctggacggcgtcaccgatcaggatcaaaaactg
gcaggtcggatcgaagaagatggccgtgcttgcgtgatcgtcgtcaacaagtgggatgcc
cacgaaaaagactccagcaccatctacgaggtggaacggcaactgcgcgatcgcctctac
ttcctcgactgggccccaatgattttcgtcagtgcgctgaccggtcagcgggttgagaag
attctcgatcaagtcaacaccgtggtggagcagcaccgtcgccgcgtcggcacttccgta
atcaatgaagtcttgggtgatgcgatcgcttggcgaacaccacctaccacacgtcaaggt
cgtcagggtcgaatttactacggcacccaagtcaccacccagccgcctagcttcaccctg
tttgtcaacgatcccaagctgtttggcgaatcctatcgccgctacattgagcgccagttc
cgggaaagcctcggcttcagcggcaccccaattcgcctcttctggcggggcaaaaaatcg
cgggaactagagcgcggcgccaatcgagcgactcgcgtttaa

DBGET integrated database retrieval system