KEGG   Synechococcus elongatus PCC6301: syc1764_c
Entry
syc1764_c         CDS       T00163                                 

Gene name
rfaE
Definition
(GenBank) ADP-heptose synthase
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Other DBs
NCBI-ProteinID: BAD79954
CyanoBase: syc1764_c
CYORF: syc1764_c
UniProt: A0A0H3KAS1
Position
complement(1909180..1910217)
AA seq 345 aa
MMRLDPTFQSQLMQERDRLISLLHCFRQAKVMVVGDLTLDEFLTGRVERLSREAPVAILR
HEETRRIPGGGANAIYNCASLGAQVLAVGLVGDDEQGRALRSIFEAVQINTQGILVEEER
PTVTKTRISGHARQSVTQQIVRLDRKSDEPPSQHHQQALAHYIAEQIDRVDAVVGSDYGD
GVLSDPVIRAIAAAPRLVIDAQVDLDRFRGATLFTPNLPEAELAVGYAIANAADLQRAGQ
DLLQKTGAKAVLITRGEEGMSLFEADGEQHHIPAFNRTDVFDVTGAGDTVVAALTLALVS
GANFWEAAVLGNLAASLVVRVFGTATTTVEAMEAALLQLTEPGVG
NT seq 1038 nt   +upstreamnt  +downstreamnt
gtgatgcgtctggacccgacatttcagtctcagttaatgcaggagcgcgatcgcttgatt
agcctcttgcactgcttccgccaagccaaagtgatggtggtcggcgatctgacgctggat
gaatttctgaccggtcgggttgagcggttatcgcgcgaagcacccgtcgcgattttgcgg
catgaggaaacgcggcgcattcctgggggaggagccaacgcaatctataactgtgccagc
ctcggcgctcaagtactggcggttggcctggtcggagatgatgagcagggtcgtgccctg
cgatcgatttttgaggccgtccagatcaatacccaaggcattctggtcgaagaagaacgc
cccacggtcacgaagacgcggatttcaggccatgctcgtcaatccgtgacgcagcagatt
gtgcggctcgatcgcaagtcggatgagccaccatcgcaacaccaccaacaagctctggcc
cactacattgctgagcaaattgatcgcgtcgatgcagtcgttggctctgactatggcgat
ggcgttctctcggatcctgtgattcgtgcgatcgcagcagctccacgtctggtcattgat
gcgcaagtggatctcgatcgctttcggggggcaaccctatttacgcccaacctgccggaa
gcagagttagcagtcggttatgcgatcgcgaatgcggcggatctccaacgggctgggcaa
gatctactccagaaaaccggcgcaaaagccgtcttgatcacccgcggcgaagagggcatg
agcttgtttgaagcggacggcgaacagcaccacattccagcttttaaccgcaccgacgtg
tttgatgtgactggcgcgggcgatacagtcgttgctgccctaacgctggctttggtatcc
ggtgcgaatttctgggaggcagcagtgcttggcaatttggccgccagccttgtggtgcgg
gtgtttggcactgcaacgaccactgtggaagcaatggaggccgctctcttgcaacttacc
gagcccggagtgggatga

DBGET integrated database retrieval system