KEGG   Synechococcus elongatus PCC6301: syc1765_c
Entry
syc1765_c         CDS       T00163                                 

Definition
(GenBank) unknown protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: TonB_C
Other DBs
NCBI-ProteinID: BAD79955
CyanoBase: syc1765_c
CYORF: syc1765_c
UniProt: A0A0H3K3P9
Position
complement(1910261..1911178)
AA seq 305 aa
MTAAPSRSLEAAPLPAPDRWRWLRNPFAIAILLSVGAHAVFFTLFPYLSDPAPAKPKREP
VQTRALTVAEFARLPESLRGAAASPSIPSRPVAPFSGLPDLSALMSPMVLPPPPSPLVLP
ELNLPTPTEPPTQLPPPPVADETPPPAPPVSNTPAPTPAESTPQSAPADTPAVDEKLYAF
NPEGTDASLGFGKLGEFVAALQTNYPDLKIPNQAIAIKLPLPESDRCFEQVKPAQFAVLV
GANGKALEPPQTLVSSGYAILNQQAIAALEKQPYPLTGRTELKLVNLEFVPPESSSCSVP
PPAAG
NT seq 918 nt   +upstreamnt  +downstreamnt
atgactgctgcgccgtctcgttccttggaggctgctcctctgccggcacccgatcgatgg
cgctggctgcgcaatccgtttgcgatcgccattttgctttcggtgggcgcccatgcggtc
ttcttcacgctcttcccttacctgtctgaccctgctcctgcgaagcccaagcgcgagccg
gtacaaactcgcgctctgacagtagcagagtttgcgcggctaccagaatcgctgcgtggc
gcggctgccagtccttcgatccccagtcgcccggtcgccccttttagtggcctgccggat
ctgtcagccctgatgtcgccgatggtgctgccgccgccgccctctcccctggttctccca
gaactcaacctaccaacccccactgagccaccgacccagttgccgcccccgcccgtcgct
gacgagacgccaccgcccgcgccaccagtgagcaatacccctgctccaacaccagcggaa
tcgacgccccagtcggctccagccgatacgccggcagttgatgagaaactctacgccttc
aacccagaaggtacagacgccagcttgggttttggcaagctcggggagtttgtcgcagcg
ctgcaaacgaactatcccgatctcaagatccccaaccaggcgatcgcgattaagctgccg
ctgcctgagagcgatcgctgctttgagcaagtaaaaccggcccagtttgccgtcctagtc
ggagccaatgggaaagccctagagcccccacaaaccttggtcagtagtggctacgcaatc
ctcaatcagcaggcgatcgctgcccttgaaaagcagccctatcctctaacgggtcggact
gaactgaagctcgtcaaccttgaatttgtgccaccggagtcctcaagttgttccgttcca
ccacctgcagccggctga

DBGET integrated database retrieval system