KEGG   Synechococcus elongatus PCC6301: syc1766_d
Entry
syc1766_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Amidase_2
Other DBs
NCBI-ProteinID: BAD79956
CyanoBase: syc1766_d
CYORF: syc1766_d
UniProt: A0A0H3K417
Position
1911471..1912430
AA seq 319 aa
MVMPGLLDLPRLLAERWRGLGRGLIACCLLLALSACSAMPSADASEAELAAILAQLPDSS
VPTGPNPFKTPSVPRNILPSRPANADSLGPVCQAMQPAIGREAYSMANFKPDVRSAWAHP
TNFGDRAAVDRNGQPVDNRISLIVLHETVASADSAINFFQTPHPRDEDQASYHALIRRNG
TIVYTVPPEKRAFGAGSSSFRGEAVRFNPKLPGSVNNFSLHVSLESPADGRDNRRRHSGY
TARQYDSLALLAQQWMTTYTIPGDRITTHAAVDRSGSRMDPRSFQWARLAQRLQLLNEGT
IPGCGDSAVSAAQLPASPN
NT seq 960 nt   +upstreamnt  +downstreamnt
gtggttatgccgggtttgctcgatcttccgcgactattggctgagcgatggcgagggctt
gggcggggcttgatcgcctgctgcctgctgttggccttgtcggcttgctcagccatgccc
agtgctgatgccagcgaagcagaactagcggccattttggctcaactgcccgattcatca
gtacctacgggacccaacccgtttaaaaccccgtcggtgccccgtaacatcctgccgtcc
cgtcctgccaatgctgactcgctcggccccgtctgtcaggcgatgcaaccggcgatcgga
cgcgaggcttacagcatggccaatttcaagcccgatgtacgctcggcttgggctcatccc
accaacttcggcgatcgtgccgcggtcgatcgcaatggccagcccgtcgataaccggatc
agtttgatcgtcttgcatgaaaccgtggcttccgctgactctgccattaacttcttccag
accccccatcctcgcgatgaggatcaggctagctatcatgcgctgattcgccgcaatgga
acgattgtttacacggtgcctccagagaagcgagcctttggtgccggctcttccagtttt
cggggcgaagctgtgcgatttaatcccaaactgccgggctcggtcaacaatttctcgctc
catgtcagccttgaatcgccagccgatggccgtgataatcgccggcgacacagtggttac
acggctcgacagtacgactcgttggccctgcttgcccagcagtggatgacaacttataca
atccccggcgatcgcattaccacccatgcagctgtggatagaagtgggtcacgcatggac
ccgcgtagtttccaatgggcgcgtttggctcagcggttgcagctattaaatgagggcacg
attccaggctgtggggactccgctgtcagcgccgctcaattgcctgccagccccaattga

DBGET integrated database retrieval system