KEGG   Synechococcus elongatus PCC6301: syc1767_d
Entry
syc1767_d         CDS       T00163                                 

Gene name
fbpI
Definition
(GenBank) fructose-1,6-bisphosphatase I
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00010  Glycolysis / Gluconeogenesis
syc00030  Pentose phosphate pathway
syc00051  Fructose and mannose metabolism
syc00680  Methane metabolism
syc00710  Carbon fixation in photosynthetic organisms
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01200  Carbon metabolism
Module
syc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syc_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc1767_d (fbpI)
   00030 Pentose phosphate pathway
    syc1767_d (fbpI)
   00051 Fructose and mannose metabolism
    syc1767_d (fbpI)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    syc1767_d (fbpI)
   00680 Methane metabolism
    syc1767_d (fbpI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syc04147]
    syc1767_d (fbpI)
Enzymes [BR:syc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     syc1767_d (fbpI)
Exosome [BR:syc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   syc1767_d (fbpI)
SSDB
Motif
Pfam: FBPase FBPase_C
Other DBs
NCBI-ProteinID: BAD79957
CyanoBase: syc1767_d
CYORF: syc1767_d
UniProt: Q5N163
Position
1913198..1914106
AA seq 302 aa
MQRIGLAAKLIARRLSHAGLVDDALGFTGEINVQGEAVKRMDVYANQVFISVFRQSGLVC
RLASEEMEKPYYIPENCPIGRYTLLYDPLDGSANVDVDLNVGSIFAVRRQEFYDESHEAK
DLLQPGDRQIAAGYVLYGASTLLVYSMGQGVHVFVLDPSLGEFVLAQSDIQLPNSGQIYS
VNEGNFWQWPEGYRQYIREMHRREGYSGRYSGALVADFHRILMQGGVFLYPETVKNPTGK
LRLLYEAAPMAFLAEQAGGKASDGQKPILLRQPQALHERCPLIIGSAADVDFVEACLAES
VP
NT seq 909 nt   +upstreamnt  +downstreamnt
atgcagcgcattggccttgccgctaagctaatcgcccgtcgcctcagccacgcggggctg
gtggatgatgccctcggtttcacgggggaaatcaacgtccagggcgaagccgtcaaacgg
atggacgtctacgctaaccaagttttcatctcagtttttcggcagagtggcttggtctgt
cggctggcttccgaggaaatggagaagccctactacattcctgaaaattgcccgatcggt
cgctatacgctgctctacgaccctttagatggctcggccaacgtcgatgtcgatctcaac
gtcggttccatttttgcggtgcggcgtcaagagttctacgacgagtcccatgaagccaag
gatcttctgcagccaggcgatcgccaaattgctgcgggctatgtcctctatggggccagc
accttgctggtctacagcatgggtcagggcgtccatgtttttgtactggaccccagctta
ggtgagtttgtcctcgcgcagtccgacatccagctcccgaactcgggtcagatctacagc
gtcaatgaagggaacttttggcagtggcccgagggctatcgccagtacatccgggaaatg
catcgccgcgaaggctacagcggccgctatagcggagcgttggtagctgacttccatcgc
attttgatgcagggtggtgtgtttctctatcccgaaaccgtcaagaatcccactggcaag
ctgcgactgctctacgaagcagcaccgatggcctttctggctgaacaagcaggcggcaag
gccagtgacggccagaagcctatcctcttgcgccaaccccaagccctgcacgagcggtgc
ccgctaattatcggtagcgccgcagatgtggactttgtcgaagcctgcttggctgagtcg
gtgccctaa

DBGET integrated database retrieval system