KEGG   Synechococcus elongatus PCC6301: syc1768_d
Entry
syc1768_d         CDS       T00163                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00030  Pentose phosphate pathway
syc00480  Glutathione metabolism
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01200  Carbon metabolism
Module
syc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
syc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    syc1768_d (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    syc1768_d (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syc04147]
    syc1768_d (zwf)
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     syc1768_d (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     syc1768_d (zwf)
Exosome [BR:syc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   syc1768_d (zwf)
  Exosomal proteins of colorectal cancer cells
   syc1768_d (zwf)
  Exosomal proteins of bladder cancer cells
   syc1768_d (zwf)
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-ProteinID: BAD79958
CyanoBase: syc1768_d
CYORF: syc1768_d
UniProt: A0A0H3K781
Position
1914153..1915688
AA seq 511 aa
MTPKLLENPLRIGLRQDKVPEPQILVIFGATGDLTQRKLVPAIYEMHLERRLPPELTIVG
VARRDWSDDYFREHLRQGVEQFGGGIQAEEVWNTFAQGLFFAPGNIDDPQFYQTLRDRLA
NLDELRGTRGNRTFYLSVAPRFFGEAAKQLGAAGMLADPAKTRLVVEKPFGRDLSSAQVL
NAILQNVCRESQIYRIDHYLGKETVQNLLVFRFANAIFEPLWNRQYIDHVQITVAETVGL
EGRAGYYETAGALRDMVQNHLMQLFSLTAMEPPNSLGADGIRNEKVKVVQATRLADIDDL
SLSAVRGQYKAGWMNGRSVPAYRDEEGADPQSFTPTYVAMKLLVDNWRWQGVPFYLRTGK
RMPKKVTEIAIQFKTVPHLMFQSATQKVNSPNVLVLRIQPNEGVSLRFEVKTPGSSQRTR
SVDMDFRYDTAFGSPTQEAYSRLLVDCMLGDQTLFTRADEVEASWRVVTPLLESWDDPRQ
AAGISFYEAGTWEPAEAEQLINRDGRRWRRL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgactcccaaactgcttgagaacccgcttcgcattggactccgccaagacaaagtccct
gaaccgcaaatcctcgtcatctttggggccaccggcgacttaacccagcgcaaactggtg
cctgccatctacgagatgcacctcgaacggcgtttgccgccagaactgacgatcgtgggg
gtggctcggcgcgactggagcgatgactatttccgagagcaccttcgccaaggggttgaa
cagtttggcggcggcattcaagcagaggaagtttggaacacctttgcacaaggcctcttc
tttgcgccgggcaacattgatgacccccagttttatcaaacccttcgcgatcgccttgcg
aatctggatgagctgcgcggcacgcggggcaatcgcactttttacctctcggtcgcaccc
cgtttctttggtgaagctgcaaaacaactcggggcagccggaatgcttgccgatccagct
aaaacgcggctggtcgtcgaaaaaccttttggccgcgatctcagctccgctcaggtgctg
aatgccatcttgcagaacgtttgccgcgaaagccagatctatcggattgaccattacctc
ggcaaagaaacagttcaaaacctcttagttttccggtttgccaatgccatttttgagccg
ctctggaaccggcaatacattgaccatgtccaaatcacggtggctgaaactgtggggttg
gaagggcgagctggctactacgaaactgctggtgctctgcgggatatggtgcaaaaccac
ttgatgcagctcttcagcctgacggcgatggagccgccaaactctctaggtgctgacggt
atccgtaacgaaaaggtcaaggtggtgcaagccacacggctggcggatatcgacgatctc
agtttgtctgcggtgcgggggcagtacaaagcgggctggatgaatggccgctctgtgccc
gcctatcgggatgaggagggagcggatccccagtcgtttacgcccacctatgtcgccatg
aaattgctggtcgacaactggcgctggcagggagtgccgttctatctacggacgggtaaa
cggatgcccaaaaaggtgacggagattgccattcagttcaaaaccgtgccgcacttgatg
ttccagtcagccacccaaaaagtgaatagtcccaacgtcttagtgctgcggattcagccc
aatgaaggcgtgtccttgcgctttgaagtgaaaacaccgggttcctcgcaacggacgcga
tcggtggatatggacttccgctacgacacggcttttggctcccccacccaagaggcctat
agccgcctgctggtggactgcatgctcggcgatcagacgctgttcacccgcgctgatgag
gttgaagcgtcttggcgggttgtgacgccgttactcgaatcttgggatgacccgcgccaa
gccgctggcatttctttttacgaagctggcacttgggagccggcagaggcggagcagttg
atcaaccgtgatggtcgccgttggcgtcgtctctag

DBGET integrated database retrieval system